BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M18 (410 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 1.9 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 24 2.5 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 22 7.6 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 22 7.6 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 24.2 bits (50), Expect = 1.9 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = +1 Query: 232 RSALPSGAQLYPHTQDATVHVERADSSLLRPRGPTRARHAKKFGRERCFPIPR 390 R+ LP+ + T+ R ++ P G R R + R RC P R Sbjct: 459 RTPLPARGHVRARLTRRTIPPTRVAAAAAAPEGRRRRRAIARARRRRCRPRAR 511 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 227 GGGARSLQALSFTLIHRTRLFMSSARTRH 313 G G +QAL + IH+ R + ++ RH Sbjct: 884 GVGIIDIQALCISQIHQLRSYFVESQNRH 912 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 22.2 bits (45), Expect = 7.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 32 RAAAKYLEGKCGATLSEKKF 91 +A + + G CGA+L K+F Sbjct: 121 QARNRKIHGNCGASLVSKRF 140 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 22.2 bits (45), Expect = 7.6 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +3 Query: 150 FLTCCRIRTIQNEKKVY 200 F CCR+R ++ ++ Y Sbjct: 199 FSKCCRLRLLERRRQCY 215 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 382,249 Number of Sequences: 2352 Number of extensions: 6541 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33349914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -