BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M13 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 25 0.44 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 25 0.44 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 1.8 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 1.8 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 3.1 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 3.1 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 5.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 5.4 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 5.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.4 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 5.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 5.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 5.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.4 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 5.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 5.4 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 9.4 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 25.4 bits (53), Expect = 0.44 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 234 YTHLYTLIVKPDNTYEVLIDNEKVES 311 Y H Y + KP N E++ N K+ES Sbjct: 428 YYHSYKMHQKPYNKDEIIYPNLKIES 453 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 25.4 bits (53), Expect = 0.44 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 234 YTHLYTLIVKPDNTYEVLIDNEKVES 311 Y H Y + KP N E++ N K+ES Sbjct: 428 YYHSYKMHQKPYNKDEIIYPNLKIES 453 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = -3 Query: 516 PTLHPSHHPNLQAYWHQGPECAQVCPSPRVSCLPGRGLW 400 P + S+ Q + + +C Q + LP RG+W Sbjct: 37 PPVRVSNGGKEQDFRFEAIQCLQSSAFKEIKTLPDRGMW 75 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 504 PSHHPNLQAYWHQGPECAQVCPSPRVSCLPGRGL 403 PS ++ G +Q+CP+PR + L G+ Sbjct: 362 PSKCSQTSVHYSNGQTHSQLCPTPRSTHLKVSGI 395 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 464 VRNVLRFVPVLGFLVFRVGDCGFVVPIFRFL 372 ++NVLRF GF FRV ++ RFL Sbjct: 205 MQNVLRFWLRRGFDGFRVDALPYICEDMRFL 235 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 464 VRNVLRFVPVLGFLVFRVGDCGFVVPIFRFL 372 ++NVLRF GF FRV ++ RFL Sbjct: 205 MQNVLRFWLRRGFDGFRVDALPYICEDMRFL 235 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -3 Query: 459 ECAQVCPSPRVSCLPGRGLW 400 +C Q + LP RG+W Sbjct: 3 QCLQSSAFKEIKTLPDRGMW 22 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = -1 Query: 575 VNLFRCPDALVVGVVDHSGFXLSIHLIIP 489 ++LFR P+ + + + L IH +P Sbjct: 112 ISLFRGPEGIQINATELQKIKLEIHRDLP 140 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +3 Query: 165 HVIFSYKGKNHLIKKDIRCKDDVYTH 242 H+++ ++G ++ KD R + Y H Sbjct: 213 HLVYPFEGDIRIVNKDRRGELFYYMH 238 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 326 GF*FTRFNLLIVDEDLVSVIRFHDES 249 GF TR+++ DL+++ FHD S Sbjct: 161 GFLRTRWSISGTVFDLINIHLFHDAS 186 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,328 Number of Sequences: 438 Number of extensions: 3946 Number of successful extensions: 39 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -