BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M12 (530 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 1.3 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 5.1 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 6.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.9 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 21 8.9 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.4 bits (48), Expect = 1.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 453 PIMKAGMEIATGIKVGPPSL 512 P + G+++ TG+ V PP L Sbjct: 436 PTAQMGLDMVTGLDVKPPGL 455 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.4 bits (43), Expect = 5.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 499 PTLIPVAISIPAFIIGTHAPSAVCASMAKLSF 404 P + P+ + P F PSA+C S A+L F Sbjct: 178 PQVPPLPLP-PIFAPTMINPSAICESAAQLLF 208 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 442 PSAVCASMAKLSF 404 PSA+C S A+L F Sbjct: 196 PSAICESAAQLIF 208 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.6 bits (41), Expect = 8.9 Identities = 6/13 (46%), Positives = 12/13 (92%) Frame = -2 Query: 175 LKFDIRAVASFTK 137 L+FD++ V+++TK Sbjct: 473 LEFDVKCVSNYTK 485 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 371 VFYSIKYISSELGE 330 ++ S+ YIS ELGE Sbjct: 58 LYPSVHYISRELGE 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,516 Number of Sequences: 336 Number of extensions: 2515 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -