BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M11 (526 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0645 + 21475126-21475293,21475386-21475538,21478101-214782... 28 5.3 03_05_0273 - 22618177-22618370,22618441-22618531 27 7.0 >12_02_0645 + 21475126-21475293,21475386-21475538,21478101-21478249, 21478449-21478526,21478604-21478697,21478920-21478994, 21479341-21479637,21479722-21479789,21479876-21479930, 21480137-21480275,21480439-21480623,21480748-21481119 Length = 610 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = -2 Query: 219 LRSRLPLPEGFVRILIHFRQVGLFNWS 139 LRS + LPE +RI+ H R++G+F+ S Sbjct: 209 LRSNIQLPE-CLRIVAHLRRIGVFSES 234 >03_05_0273 - 22618177-22618370,22618441-22618531 Length = 94 Score = 27.5 bits (58), Expect = 7.0 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 280 TRNLLLIKM*FPGGVRGLTWPSQPAAAAGGFCSYSDPLQAGR 155 TR L+ + V +WP QP AA GFC ++ GR Sbjct: 3 TRRAALLMLLLLVVVAAASWP-QPCDAASGFCGSKCAVRCGR 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,685,915 Number of Sequences: 37544 Number of extensions: 177883 Number of successful extensions: 537 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -