BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M11 (526 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025458-5|AAB70974.1| 298|Caenorhabditis elegans Squat protein... 32 0.22 U97193-5|AAV34804.1| 783|Caenorhabditis elegans Hypothetical pr... 29 2.0 U14635-8|AAK84492.1| 307|Caenorhabditis elegans Collagen protei... 28 3.6 L15418-1|AAA17445.1| 307|Caenorhabditis elegans col-36 collagen... 28 3.6 Z78060-3|CAB01488.2| 215|Caenorhabditis elegans Hypothetical pr... 27 8.2 >AF025458-5|AAB70974.1| 298|Caenorhabditis elegans Squat protein 2 protein. Length = 298 Score = 32.3 bits (70), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 171 GSEYEQNPPAAAAGCEGQVRPRTPPG 248 G E Q PP GCE PRTPPG Sbjct: 272 GPEGPQGPPGEPGGCEHCPIPRTPPG 297 >U97193-5|AAV34804.1| 783|Caenorhabditis elegans Hypothetical protein C06A5.3b protein. Length = 783 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 7/41 (17%) Frame = +3 Query: 150 RVRPA*SG-SEYEQNPPAAAAG------CEGQVRPRTPPGN 251 R RP G S+ E+ PP +A+G C GQVRP+ GN Sbjct: 478 RARPKHYGYSKVEKTPPISASGHRHCVNCNGQVRPQMCGGN 518 >U14635-8|AAK84492.1| 307|Caenorhabditis elegans Collagen protein 36 protein. Length = 307 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 171 GSEYEQNPPAAAAGCEGQVRPRTPPG 248 G + Q PP C+ PRTPPG Sbjct: 281 GPQGPQGPPGDEGSCDHCPEPRTPPG 306 >L15418-1|AAA17445.1| 307|Caenorhabditis elegans col-36 collagen protein. Length = 307 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 171 GSEYEQNPPAAAAGCEGQVRPRTPPG 248 G + Q PP C+ PRTPPG Sbjct: 281 GPQGPQGPPGDEGSCDHCPEPRTPPG 306 >Z78060-3|CAB01488.2| 215|Caenorhabditis elegans Hypothetical protein C34D1.4 protein. Length = 215 Score = 27.1 bits (57), Expect = 8.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 278 RHPVSKLSLSTSIYLLFHFSF 340 RH + LSL T IYLL H F Sbjct: 19 RHLIFSLSLHTLIYLLLHMCF 39 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,407,800 Number of Sequences: 27780 Number of extensions: 155603 Number of successful extensions: 556 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1028310386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -