BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M09 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 1.8 X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 22 4.1 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 22 4.1 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 22 4.1 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 9.6 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 154 LMALKISTPLRIMPAAQKVSNWPGTWTTKRPRRGSVI 264 ++AL T +I A KV + +W +RP G + Sbjct: 7 ILALFALTTTQIHAATDKVICYYASWGAQRPGNGQFV 43 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 308 DEQADRLRLPEDRHRHRRPSQRELEETQ 391 +EQA R R ++RH+ ++ +++ E Q Sbjct: 72 NEQARREREEQERHKQQQQEKQQKIEQQ 99 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 308 DEQADRLRLPEDRHRHRRPSQRELEETQ 391 +EQA R R ++RH+ ++ +++ E Q Sbjct: 223 NEQARREREEQERHKQQQQEKQQKIEQQ 250 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.8 bits (44), Expect = 4.1 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 308 DEQADRLRLPEDRHRHRRPSQRELEETQ 391 +EQA R R ++RH+ ++ +++ E Q Sbjct: 282 NEQARREREEQERHKQQQQEKQQKIEQQ 309 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = -2 Query: 109 NSTLFQLLAAIIVSHFSFVINALASMA 29 N+T +L + SHF F++ ++ M+ Sbjct: 230 NATYGLILLLMFTSHFIFIVVSIFYMS 256 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,459 Number of Sequences: 336 Number of extensions: 2286 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -