BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M08 (533 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) 38 0.006 At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) simi... 37 0.007 At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) 33 0.12 At5g55480.1 68418.m06910 glycerophosphoryl diester phosphodieste... 31 0.64 At5g58050.1 68418.m07265 glycerophosphoryl diester phosphodieste... 30 0.84 At5g20940.1 68418.m02488 glycosyl hydrolase family 3 protein bet... 30 0.84 At1g18260.1 68414.m02277 suppressor of lin-12-like protein-relat... 30 0.84 At4g26690.1 68417.m03846 glycerophosphoryl diester phosphodieste... 29 1.5 At5g27290.1 68418.m03258 expressed protein predicted proteins, A... 28 3.4 At5g21222.1 68418.m02532 protein kinase family protein contains ... 28 3.4 At2g27110.2 68415.m03258 far-red impaired responsive protein, pu... 28 3.4 At2g27110.1 68415.m03257 far-red impaired responsive protein, pu... 28 3.4 At5g66520.1 68418.m08387 pentatricopeptide (PPR) repeat-containi... 28 4.5 At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, puta... 28 4.5 At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding ... 28 4.5 At1g66970.1 68414.m07615 glycerophosphoryl diester phosphodieste... 28 4.5 At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / lon... 27 7.9 At3g47000.1 68416.m05104 glycosyl hydrolase family 3 protein bet... 27 7.9 At1g79340.1 68414.m09246 latex-abundant protein, putative (AMC7)... 27 7.9 At1g77800.1 68414.m09059 PHD finger family protein contains Pfam... 27 7.9 At1g19570.1 68414.m02437 dehydroascorbate reductase, putative si... 27 7.9 At1g19550.1 68414.m02435 dehydroascorbate reductase, putative si... 27 7.9 >At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) Length = 135 Score = 37.5 bits (83), Expect = 0.006 Identities = 28/72 (38%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = +3 Query: 39 VIGKDSLMKADVKMKEICIMKLLNYV-LQPTVYE---DIKEVAREYMLEENTDKYSK-SD 203 VI KDS K K + C +KL+NY L PT Y D+KEVA L+ K + + Sbjct: 53 VIRKDSAKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALQSKDKKVAALKE 112 Query: 204 VVTKFMETFKMG 239 K E FK G Sbjct: 113 AKAKLEERFKTG 124 >At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) similar to 60S RIBOSOMAL PROTEIN L27 GB:P41101 from [Solanum tuberosum] Length = 135 Score = 37.1 bits (82), Expect = 0.007 Identities = 28/72 (38%), Positives = 35/72 (48%), Gaps = 5/72 (6%) Frame = +3 Query: 39 VIGKDSLMKADVKMKEICIMKLLNYV-LQPTVYE---DIKEVAREYMLEENTDKYSK-SD 203 VI KDS K K + C +KL+NY L PT Y D+KEVA L+ K + + Sbjct: 53 VIRKDSAKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALKSKDKKVTALKE 112 Query: 204 VVTKFMETFKMG 239 K E FK G Sbjct: 113 AKAKLEERFKTG 124 >At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) Length = 135 Score = 33.1 bits (72), Expect = 0.12 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 5/72 (6%) Frame = +3 Query: 39 VIGKDSLMKADVKMKEICIMKLLNYV-LQPTVYE---DIKEVAREYMLEENTDKYSK-SD 203 VI KDS K K + C K++NY + PT Y D+K V + K + + Sbjct: 53 VIRKDSAKKTAKKSRVKCFFKVINYQHVMPTRYTLDLDLKNVVSADAISSKDKKVTALKE 112 Query: 204 VVTKFMETFKMG 239 KF E FK G Sbjct: 113 AKAKFEERFKTG 124 >At5g55480.1 68418.m06910 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family; similar to Glycerophosphoryl diester phosphodiesterase precursor (Glycerophosphodiester phosphodiesterase) (Surface-exposed lipoprotein D) (Protein D) (ImmunoglobulinD-binding protein) (IGD-binding protein) (SP:Q06282) {Haemophilus influenzae} Length = 766 Score = 30.7 bits (66), Expect = 0.64 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 9/123 (7%) Frame = +3 Query: 126 TVYEDIKEVAREYM--LEENTDKYSKSDVVTK--FMETFKMGMLPRGEVFVHTNALQMEQ 293 TVY+ ++E R+ + E+ K++ + V++K T + + ++ Q+ Sbjct: 562 TVYK-VEETIRDILDTAIEDIKKFADAVVISKKSVFPTSESFTTGQTKLVERLQKFQLPV 620 Query: 294 AVKVFRILYFAKDYDYFIKTACWLRER-----INGGMFVYALTAAVFHRSDCVGITLPAP 458 V+VFR + ++ +D+F + ING + + LTAA + R+ C+ P Sbjct: 621 YVEVFRNEFVSQPWDFFADATVEINSHVTGAGINGTITEFPLTAARYKRNSCLTRKDVPP 680 Query: 459 YEI 467 Y I Sbjct: 681 YMI 683 >At5g58050.1 68418.m07265 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family; similar to Glycerophosphoryl diester phosphodiesterase precursor (Glycerophosphodiester phosphodiesterase) (Surface-exposed lipoprotein D) (Protein D) (ImmunoglobulinD-binding protein) (IGD-binding protein) (SP:Q06282) {Haemophilus influenzae} Length = 753 Score = 30.3 bits (65), Expect = 0.84 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 5/64 (7%) Frame = +3 Query: 297 VKVFRILYFAKDYDYF----IKTACWLRER-INGGMFVYALTAAVFHRSDCVGITLPAPY 461 V V R Y A +DYF I+ A ++ R ++G + + TA + RS C + PY Sbjct: 608 VSVLRNEYIAIAFDYFSDPTIELATFIAGRGVDGVITEFPATATRYLRSPCSDLNKDQPY 667 Query: 462 EIYP 473 I P Sbjct: 668 AILP 671 >At5g20940.1 68418.m02488 glycosyl hydrolase family 3 protein beta-glucosidase, common nasturtium, PIR:T10521 Length = 626 Score = 30.3 bits (65), Expect = 0.84 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 434 AVRPVEDCSSESIYEHAPVNAFP*PASSFDEVVIVLGEVQYAENF 300 AV+ D ++ IY P F A FD ++ +GE YAE F Sbjct: 476 AVKKTVDPKTQVIYNQNPDTNFV-KAGDFDYAIVAVGEKPYAEGF 519 >At1g18260.1 68414.m02277 suppressor of lin-12-like protein-related / sel-1 protein-related similar to Sel-1 homolog precursor (Suppressor of lin-12-like protein) (Sel-1L)(SP:Q9UBV2) {Homo sapiens} Length = 678 Score = 30.3 bits (65), Expect = 0.84 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = -1 Query: 212 RNNIGFRVLVRVF--LQHIFPRDFLDVLVHSWLQYVVQEFHDADLLHFHICLHETVFSDN 39 R N VLVRV L ++P+ V +W++ VV E +A +L +CL ++ Sbjct: 591 RRNYADTVLVRVVDSLPEVYPK------VETWIENVVFEEGNATILTLFVCLITILYLRE 644 Query: 38 NVERVISVVDD 6 R + VV D Sbjct: 645 RQRRQVVVVAD 655 >At4g26690.1 68417.m03846 glycerophosphoryl diester phosphodiesterase family protein weak similarity to glycerophosphodiester phosphodiesterase [Borrelia hermsii] GI:1399038; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 759 Score = 29.5 bits (63), Expect = 1.5 Identities = 30/118 (25%), Positives = 51/118 (43%), Gaps = 18/118 (15%) Frame = +3 Query: 162 YMLEENTDKYSKSDV--VTKFMETF---KMGMLPRGEVFVHTNA-----LQMEQA---VK 302 Y +EEN S + + KF + K+ + P + F+ T LQ Q V+ Sbjct: 557 YKVEENIRDILDSAIEDIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVE 616 Query: 303 VFRILYFAKDYDYFIKTACWLRERI-----NGGMFVYALTAAVFHRSDCVGITLPAPY 461 +F+ + ++ YD+F + I NG + + TAA + R+ C+G PY Sbjct: 617 LFQNEFLSQPYDFFADATVEINSYITGAGINGTITEFPFTAARYKRNLCLGRKETIPY 674 >At5g27290.1 68418.m03258 expressed protein predicted proteins, Arabidopsis thaliana Length = 341 Score = 28.3 bits (60), Expect = 3.4 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +3 Query: 216 FMETFKMGMLPRGEVFVHTNALQMEQAVKVFRILYFAKDYDYFIKTACWLRERINGGMFV 395 F+ + +G+LPRG ALQ E ++ + F DY++ E +N G Sbjct: 191 FLVAYLVGILPRGYTLSSLEALQKEGSLNIQAGSAFV-DYEFL--------EEVNSG--- 238 Query: 396 YALTAAVFHRSDCVGIT-LPAPYEIYPY 476 ++A + +R C+ + + Y +Y Y Sbjct: 239 -KVSATMLNRFSCIALAGVATEYLLYGY 265 >At5g21222.1 68418.m02532 protein kinase family protein contains Pfam profile: PF00069 protein kinase domain Length = 831 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +3 Query: 36 VVIGKDSLMK---ADVKMKEICIMKLLNYVLQPTVYEDIKEVAREYMLEE 176 +++ KD ++K A+ +EI IMKL+N+ +YE + A+ Y++ E Sbjct: 42 MILDKDKVLKHKMAEQIKREISIMKLINHPNVVQLYEVLASKAKIYIVLE 91 >At2g27110.2 68415.m03258 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 255 EVFVHT-NALQMEQAVKVFRILYFAKDYDYFIKTACWLRERIN 380 E F HT N ++ + FR+ F D +I T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At2g27110.1 68415.m03257 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282 Length = 851 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 255 EVFVHT-NALQMEQAVKVFRILYFAKDYDYFIKTACWLRERIN 380 E F HT N ++ + FR+ F D +I T C+ R N Sbjct: 495 ETFAHTANRIEDDGTTSTFRVANFENDNKAYIVTFCYPEMRAN 537 >At5g66520.1 68418.m08387 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 620 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +3 Query: 201 DVVTKFMETFKMGMLPRGEVFVHT-NALQMEQAVKVFRILYFAKDYDYFIK 350 + ++KFME KMG+ P F A V+ ++++++ + DY +K Sbjct: 331 EAISKFMEMQKMGIKPNVITFTAVLTACSYTGLVEEGKLIFYSMERDYNLK 381 >At4g11030.1 68417.m01794 long-chain-fatty-acid--CoA ligase, putative / long-chain acyl-CoA synthetase, putative similar to acyl-CoA synthetase (MF7P) gi:1617270 from Brassica napus Length = 666 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 253 PRGSMPILKVSMNFVTTSDFEYLSVFS-SSIYSLATSLMSSYTVGCST*FKSFMMQIS 83 P GSM I+ N + EY++V + ++YS + S + G S F+SF++ I+ Sbjct: 508 PNGSMKIIDRKKNIFKLAQGEYVAVENLENVYSQVEVIESIWVYGNS--FESFLVAIA 563 >At3g19040.1 68416.m02418 ubiquitin family protein / DNA-binding bromodomain-containing protein low similarity to SP|P51123 Transcription initiation factor TFIID 230 kDa subunit {Drosophila melanogaster}; contains Pfam profiles: PF00439 bromodomain, PF00240: Ubiquitin family Length = 1700 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/52 (23%), Positives = 22/52 (42%) Frame = +1 Query: 124 QLCTRTSRKSRGNICWRKTRTSTRNPMLLRNSWRPSKWACYRVVRSSFTQMR 279 Q+C+ R + G CW K R + P+ L P Y + + +++ Sbjct: 783 QVCSDLERDANGKACWSKKRKFDKIPLGLNTLVAPEDVCSYESMLAGLFRLK 834 >At1g66970.1 68414.m07615 glycerophosphoryl diester phosphodiesterase family protein contains Pfam PF03009 : Glycerophosphoryl diester phosphodiesterase family Length = 763 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Frame = +3 Query: 282 QMEQAVKVFRILYFAKDYDYFIKTACWLRERI-----NGGMFVYALTAAVFHRSDCVGIT 446 Q+ V++FR + ++ YD+F + I NG + + TAA + R+ C+G Sbjct: 617 QLPVYVELFRNEFVSQAYDFFSDATVEINAYIYGAGINGTITEFPFTAARYKRNRCLGRE 676 Query: 447 LPAPY 461 PY Sbjct: 677 EVPPY 681 >At4g23850.1 68417.m03429 long-chain-fatty-acid--CoA ligase / long-chain acyl-CoA synthetase nearly identical to acyl-CoA synthetase (MF7P) from Brassica napus [gi:1617270] Length = 666 Score = 27.1 bits (57), Expect = 7.9 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 253 PRGSMPILKVSMNFVTTSDFEYLSVFS-SSIYSLATSLMSSYTVGCST*FKSFMMQIS 83 P GSM I+ N S EY++V + +IY ++ S + G S F+SF++ I+ Sbjct: 508 PDGSMKIIDRKKNIFKLSQGEYVAVENIENIYGEVQAVDSVWVYGNS--FESFLIAIA 563 >At3g47000.1 68416.m05104 glycosyl hydrolase family 3 protein beta-D-glucan exohydrolase, Nicotiana tabacum, TREMBL:AB017502_1 Length = 608 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 437 DAVRPVEDCSSESIYEHAPVNAFP*PASSFDEVVIVLGEVQYAE 306 DA++ +E IYE P + F ++ +GE YAE Sbjct: 453 DAIKEAVGDETEVIYEKTPSKETLASSEGFSYAIVAVGEPPYAE 496 >At1g79340.1 68414.m09246 latex-abundant protein, putative (AMC7) / caspase family protein similar to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam domain, PF00656: ICE-like protease (caspase) p20 domain Length = 418 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 140 HQGSREGIYAGGKHGQV 190 H GS+E +YAGG G V Sbjct: 316 HVGSKEEVYAGGSRGSV 332 >At1g77800.1 68414.m09059 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1423 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/60 (25%), Positives = 33/60 (55%) Frame = +3 Query: 114 VLQPTVYEDIKEVAREYMLEENTDKYSKSDVVTKFMETFKMGMLPRGEVFVHTNALQMEQ 293 ++ P+V ED ++ +++ + ++K V+T +FK LP+G +V + LQ ++ Sbjct: 1338 IVSPSVSEDGDNGSKPK--KQHVETFAKELVMTSDEASFKNRRLPKGYFYVPVDCLQEDK 1395 >At1g19570.1 68414.m02437 dehydroascorbate reductase, putative similar to GB:BAA90672 from (Oryza sativa) Length = 213 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 256 SPRGSMPILKVSMNFVTTSD 197 SP+G +P+LK+ +VT SD Sbjct: 55 SPQGKVPVLKIDDKWVTDSD 74 >At1g19550.1 68414.m02435 dehydroascorbate reductase, putative similar to dehydroascorbate reductase [Arabidopsis thaliana] gi|10952514|gb|AAG24946 Length = 153 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 256 SPRGSMPILKVSMNFVTTSD 197 SP+G +P+LK+ +VT SD Sbjct: 19 SPQGKVPVLKIDDKWVTDSD 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,157,318 Number of Sequences: 28952 Number of extensions: 240142 Number of successful extensions: 734 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -