BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M05 (522 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase... 24 2.7 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 2.7 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 8.2 >AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase alternate isoform protein. Length = 257 Score = 24.2 bits (50), Expect = 2.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 294 ENKEHRLTPNYHWVEVPQMSPCVVFV 371 ++ ++ N+ V+VPQ P VVFV Sbjct: 221 KDSSKKIVNNFRSVQVPQQVPEVVFV 246 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 24.2 bits (50), Expect = 2.7 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 108 LVFTYTFRYRYYCCVFIYCILTFY 37 ++F + F ++ CV I+C L Y Sbjct: 261 IIFRWVFLGQFIQCVMIWCSLVLY 284 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 126 CWFV*FLVFTYTFRYRYYCCVFIYCILTFY 37 C F+ F + F ++ C I+C L Y Sbjct: 274 CVFLLETTFRWVFFVQFIQCTMIWCSLILY 303 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 599,777 Number of Sequences: 2352 Number of extensions: 13235 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -