BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_M02 (689 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_20479| Best HMM Match : Collagen (HMM E-Value=1) 29 4.7 >SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 31.9 bits (69), Expect = 0.50 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +1 Query: 19 WFSSDAAGTHLLVFDDRFSNPRVVATQAGIISKCPTNSCLWFLHVCFSLPKAHAYYIVES 198 WF D +H L +D R S R+V + +C S + + F LP H Y+ + Sbjct: 835 WFPYDGTRSHSLAYDRRASLHRIVRDREMEAFECIEKSLSFHHRLLFHLP--HLTYLFRA 892 Query: 199 RW-VRTYV 219 R+ +R ++ Sbjct: 893 RYRIRPFI 900 >SB_20479| Best HMM Match : Collagen (HMM E-Value=1) Length = 1214 Score = 28.7 bits (61), Expect = 4.7 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 458 FF*HIKFNKKPPEVSLIGVSVKWTLLS 538 F+ +++FN P+VS +G+ KW L+ Sbjct: 449 FYPYVQFNLNDPQVSPVGIENKWFYLA 475 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,484,064 Number of Sequences: 59808 Number of extensions: 279363 Number of successful extensions: 488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -