BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L24 (508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 29 0.12 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 1.9 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 3.4 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 5.9 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 5.9 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 5.9 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 28.7 bits (61), Expect = 0.12 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 141 PMSAFFKAGESLTPSPVTATMAPMRWQPSTMISFCW 34 P+ AF + +T T+AP W P+ ISFC+ Sbjct: 84 PLQAFHRV---ITMENFMKTLAPSLWPPAERISFCY 116 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 1.9 Identities = 19/57 (33%), Positives = 26/57 (45%) Frame = -2 Query: 252 IRRPSSTPVTIEAKLSSSRIISAACLETSEPAIPIATPMSAFFKAGESLTPSPVTAT 82 I RP+ P T E K ++S S + LET + A A+ S T S V+ T Sbjct: 112 IPRPAEVPTTPEHKSAASSSCSLSTLET-QTATAGASVQSLPIAIATGATSSTVSLT 167 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 355 RHRLPSSASIWEPTWCQQLLSHTKRP 432 R+ P A + WCQ++L+ +RP Sbjct: 792 RYGAPIWAEATDRQWCQRMLASFQRP 817 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 397 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 429 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 5.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 402 APCRFPDRCRGWQTVPRGSGISHRMKARKGDIS 304 AP FP+ G QT PR + + GD++ Sbjct: 381 APNYFPNSFSGPQTCPRAHKLQNTPLKLSGDVN 413 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,991 Number of Sequences: 2352 Number of extensions: 10509 Number of successful extensions: 40 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -