BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L22 (497 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.58 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 3.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.4 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 24.6 bits (51), Expect = 0.58 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 113 NVWLWTAITLDGTSHTTHLEMYFT 42 N WLWT G ++ ++E+ FT Sbjct: 70 NNWLWTPFIERGPANRMYIEIKFT 93 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -1 Query: 122 GMSNVWLWTAITLDGTSHTTHLEMYFTISFPSTGII 15 G S V + AI G TH Y I F GI+ Sbjct: 134 GWSAVVITAAICTSGIVGRTHTVGYIIIGFLLAGIV 169 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 301 LQSDGKYHL 275 LQ DGK+HL Sbjct: 179 LQGDGKFHL 187 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 301 LQSDGKYHL 275 LQ DGK+HL Sbjct: 179 LQGDGKFHL 187 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,830 Number of Sequences: 438 Number of extensions: 2995 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -