BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L21 (599 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe... 26 4.8 SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|... 26 4.8 SPBC29A3.09c |||AAA family ATPase Gcn20 |Schizosaccharomyces pom... 25 8.5 SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc... 25 8.5 >SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe|chr 1|||Manual Length = 371 Score = 25.8 bits (54), Expect = 4.8 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -3 Query: 246 PHPFTHCNSVATSLLPDEA----LMVEYWAKRWVGREPVGQASA-FSP 118 P PF H N + T L ++A + ++ + R + VGQ+S+ FSP Sbjct: 102 PKPFLHTNRLGTGSLIEDAPPTQSIYDFSSSRQINALNVGQSSSPFSP 149 >SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|Schizosaccharomyces pombe|chr 2|||Manual Length = 784 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 213 TSLLPDEALMVEYWAKRWVGRE 148 TS+ DE EYW KR+V RE Sbjct: 319 TSMQLDEDYTDEYWEKRYVIRE 340 >SPBC29A3.09c |||AAA family ATPase Gcn20 |Schizosaccharomyces pombe|chr 2|||Manual Length = 736 Score = 25.0 bits (52), Expect = 8.5 Identities = 6/26 (23%), Positives = 14/26 (53%) Frame = -3 Query: 273 VSHSCGDIPPHPFTHCNSVATSLLPD 196 + ++C ++ PH ++C A + D Sbjct: 5 IQNNCSEVDPHVLSYCTGYANDAIKD 30 >SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 997 Score = 25.0 bits (52), Expect = 8.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 21 WDGDDTGLRQHCTASP-LRQAHRASSVLRPN 110 W+ DD L++H T SP A+ SS PN Sbjct: 78 WEDDDDPLKEHITHSPSCPWAYILSSKNNPN 108 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,624,254 Number of Sequences: 5004 Number of extensions: 56558 Number of successful extensions: 111 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -