BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L19 (555 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.017 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.039 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.039 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.051 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.051 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.051 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.068 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.068 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 33 0.12 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 33 0.16 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 33 0.16 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 32 0.27 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 32 0.27 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 32 0.27 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 32 0.27 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 31 0.48 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 31 0.48 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 31 0.48 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 31 0.48 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 31 0.48 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 31 0.63 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 31 0.63 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 31 0.63 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 31 0.63 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 31 0.63 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 31 0.63 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 31 0.63 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 31 0.63 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 31 0.63 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 31 0.63 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 31 0.63 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 31 0.63 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 31 0.63 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 31 0.63 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 31 0.63 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_28769| Best HMM Match : ig (HMM E-Value=1e-06) 31 0.84 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 31 0.84 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 31 0.84 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 31 0.84 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 30 1.1 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 30 1.1 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 30 1.1 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 30 1.5 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 30 1.5 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_5539| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.033) 30 1.5 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 29 1.9 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 29 1.9 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 29 1.9 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 29 1.9 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 29 1.9 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_54017| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_38744| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 1.9 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_12870| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 2.6 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 2.6 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 29 2.6 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 29 2.6 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 2.6 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 29 2.6 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 29 2.6 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 29 2.6 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 29 2.6 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 2.6 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 29 2.6 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 29 2.6 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 29 2.6 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 29 2.6 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 29 2.6 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 29 2.6 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 29 2.6 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 29 2.6 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 29 2.6 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 29 2.6 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 29 2.6 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 29 2.6 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 2.6 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 29 2.6 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 29 2.6 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 29 2.6 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 29 2.6 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 29 2.6 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 29 2.6 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 29 2.6 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 29 2.6 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 29 2.6 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 2.6 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 29 2.6 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = -2 Query: 92 THTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T++RPR++SCSPGDPLV PPR SS+ S Sbjct: 17 TNSRPRSNSCSPGDPLVLERPPPRWSSNSPYS 48 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 38.7 bits (86), Expect = 0.003 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Frame = -2 Query: 122 NIRYIEHATRTHT--RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 NI YI TR + R R++SCSPGDPLV PPR SS+ S Sbjct: 12 NIAYIRQRTRVASLCRSRSNSCSPGDPLVLERPPPRWSSNSPYS 55 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 36.7 bits (81), Expect = 0.013 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = -2 Query: 131 RFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R C+ + +R + R++SCSPGDPLV PPR SS+ S Sbjct: 48 RLCSREFCASLSRLQRQGRSNSCSPGDPLVLERPPPRWSSNSPYS 92 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.7 bits (81), Expect = 0.013 Identities = 19/33 (57%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R RPR++SCSPGDPLV PPR SS+ S Sbjct: 11 RKPARPRSNSCSPGDPLVLERPPPRWSSNSPYS 43 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 36.3 bits (80), Expect = 0.017 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -2 Query: 152 LITEDITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 LIT D TR + H P ++SCSPGDPLV PPR SS+ S Sbjct: 116 LITGDYTRVQAQNPLGRQKVGHFAPSSNSCSPGDPLVLERPPPRWSSNSPYS 167 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.017 Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -2 Query: 104 HATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H+ T T R++SCSPGDPLV PPR SS+ S Sbjct: 3 HSATTTTLTRSNSCSPGDPLVLERPPPRWSSNSPYS 38 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.9 bits (79), Expect = 0.022 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -2 Query: 152 LITEDITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 LI+ +I +CN + + T +P+++SCSPGDPLV PPR SS+ S Sbjct: 8 LISANIL-YCN-KQLVIIRATRRKPQSNSCSPGDPLVLERPPPRWSSNSPYS 57 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 35.5 bits (78), Expect = 0.029 Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 7/52 (13%) Frame = -2 Query: 137 ITRFCNIRYIEHAT----RTHTRPR-ADSCSPGDPLV--*TPPRGSSSCSLS 3 I R C++R AT RT +P ++SCSPGDPLV PPR SS+ S Sbjct: 20 IPRRCHVRVFMPATATSFRTSNKPTISNSCSPGDPLVLERPPPRWSSNSPYS 71 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 35.1 bits (77), Expect = 0.039 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = -2 Query: 116 RYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 RY + H R ++SCSPGDPLV PPR SS+ S Sbjct: 43 RYCMRSPDAHCRVPSNSCSPGDPLVLERPPPRWSSNSPYS 82 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.1 bits (77), Expect = 0.039 Identities = 19/34 (55%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -2 Query: 98 TRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T T RP ++SCSPGDPLV PPR SS+ S Sbjct: 5 TGTTERPGSNSCSPGDPLVLERPPPRWSSNSPYS 38 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect = 0.051 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R TR +++SCSPGDPLV PPR SS+ S Sbjct: 5 RMKTREKSNSCSPGDPLVLERPPPRWSSNSPYS 37 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.7 bits (76), Expect = 0.051 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 6/49 (12%) Frame = -2 Query: 131 RFCNIRYIEHATRTHTRPR----ADSCSPGDPLV--*TPPRGSSSCSLS 3 +F ++ Y+ H T+ +P ++SCSPGDPLV PPR SS+ S Sbjct: 6 KFLHLLYVWHDTKAPFKPGKHLPSNSCSPGDPLVLERPPPRWSSNSPYS 54 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect = 0.051 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H + R++SCSPGDPLV PPR SS+ S Sbjct: 1 HNKKRSNSCSPGDPLVLERPPPRWSSNSPYS 31 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.3 bits (75), Expect = 0.068 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 4/47 (8%) Frame = -2 Query: 131 RFCNIRYIEHATRTHTR-PR-ADSCSPGDPLV--*TPPRGSSSCSLS 3 R C + Y ++ T + PR ++SCSPGDPLV PPR SS+ S Sbjct: 6 RACELNYADNGTNGASLVPRPSNSCSPGDPLVLERPPPRWSSNSPYS 52 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.3 bits (75), Expect = 0.068 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -2 Query: 122 NIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 NI Y + + +HT ++SCSPGDPLV PPR SS+ S Sbjct: 12 NISYPKRNSNSHTA--SNSCSPGDPLVLERPPPRWSSNSPYS 51 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.090 Identities = 17/28 (60%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 PR++SCSPGDPLV PPR SS+ S Sbjct: 2 PRSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 33.9 bits (74), Expect = 0.090 Identities = 17/28 (60%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 PR++SCSPGDPLV PPR SS+ S Sbjct: 68 PRSNSCSPGDPLVLERPPPRWSSNSPYS 95 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.9 bits (74), Expect = 0.090 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHEG 82 +WSS AA +LVDPPGCRN EG Sbjct: 3 NWSSTAVAAALELVDPPGCRNSIEG 27 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.9 bits (74), Expect = 0.090 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = -2 Query: 140 DITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +I F ++ ++ + H ++SCSPGDPLV PPR SS+ S Sbjct: 2 EIVNFDDVERVDKEPKHHFLLPSNSCSPGDPLVLERPPPRWSSNSPYS 49 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + H R++SCSPGDPLV PPR SS+ S Sbjct: 33 KNHKNYRSNSCSPGDPLVLERPPPRWSSNSPYS 65 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -2 Query: 92 THTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +H R ++SCSPGDPLV PPR SS+ S Sbjct: 37 SHKRSSSNSCSPGDPLVLERPPPRWSSNSPYS 68 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.5 bits (73), Expect = 0.12 Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 RT R++SCSPGDPLV PPR SS+ S Sbjct: 2 RTDAYERSNSCSPGDPLVLERPPPRWSSNSPYS 34 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 33.5 bits (73), Expect = 0.12 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = -2 Query: 146 TEDITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +E +RF ++R ++ P ++SCSPGDPLV PPR SS+ S Sbjct: 49 SERKSRFEDLRQCIQIQGSNWYPPSNSCSPGDPLVLERPPPRWSSNSPYS 98 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 33.5 bits (73), Expect = 0.12 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 RP ++SCSPGDPLV PPR SS+ S Sbjct: 4 RPTSNSCSPGDPLVLERPPPRWSSNSPYS 32 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -2 Query: 92 THTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T T P ++SCSPGDPLV PPR SS+ S Sbjct: 178 TTTIPPSNSCSPGDPLVLERPPPRWSSNSPYS 209 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -2 Query: 92 THTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T T R++SCSPGDPLV PPR SS+ S Sbjct: 870 TSTVKRSNSCSPGDPLVLERPPPRWSSNSPYS 901 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.16 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -2 Query: 107 EHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + + R H ++SCSPGDPLV PPR SS+ S Sbjct: 4 QQSDRPHIHRASNSCSPGDPLVLERPPPRWSSNSPYS 40 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.1 bits (72), Expect = 0.16 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHEGECV 91 +WSS AA +LVDPPGCRN +G V Sbjct: 20 NWSSTAVAAALELVDPPGCRNSIDGNGV 47 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 33.1 bits (72), Expect = 0.16 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H R ++SCSPGDPLV PPR SS+ S Sbjct: 52 HVRALSNSCSPGDPLVLERPPPRWSSNSPYS 82 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -2 Query: 92 THTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T T R++SCSPGDPLV PPR SS+ S Sbjct: 55 TVTHRRSNSCSPGDPLVLERPPPRWSSNSPYS 86 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.16 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -2 Query: 98 TRTHTRPRA-DSCSPGDPLV--*TPPRGSSSCSLS 3 T HT RA +SCSPGDPLV PPR SS+ S Sbjct: 11 TLDHTERRASNSCSPGDPLVLERPPPRWSSNSPYS 45 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 33.1 bits (72), Expect = 0.16 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = -2 Query: 152 LITEDITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 L E I RF +RY A + R++SCSPGDPLV PPR SS+ S Sbjct: 191 LSIEHIPRFL-LRYYGSA-QNGKHLRSNSCSPGDPLVLERPPPRWSSNSPYS 240 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.1 bits (72), Expect = 0.16 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +T+ R ++SCSPGDPLV PPR SS+ S Sbjct: 10 QTYQRVESNSCSPGDPLVLERPPPRWSSNSPYS 42 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R R++SCSPGDPLV PPR SS+ S Sbjct: 22 RSRSNSCSPGDPLVLERPPPRWSSNSPYS 50 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.7 bits (71), Expect = 0.21 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 HT P ++SCSPGDPLV PPR SS+ S Sbjct: 60 HTNP-SNSCSPGDPLVLERPPPRWSSNSPYS 89 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 ++ TR ++SCSPGDPLV PPR SS+ S Sbjct: 17 QSQTRVTSNSCSPGDPLVLERPPPRWSSNSPYS 49 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R H+ ++SCSPGDPLV PPR SS+ S Sbjct: 8 RLHSGKASNSCSPGDPLVLERPPPRWSSNSPYS 40 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H R++SCSPGDPLV PPR SS+ S Sbjct: 106 HRDQRSNSCSPGDPLVLERPPPRWSSNSPYS 136 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + R R++SCSPGDPLV PPR SS+ S Sbjct: 2 YRRRRSNSCSPGDPLVLERPPPRWSSNSPYS 32 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 RP ++SCSPGDPLV PPR SS+ S Sbjct: 62 RPVSNSCSPGDPLVLERPPPRWSSNSPYS 90 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R R++SCSPGDPLV PPR SS+ S Sbjct: 8 RTRSNSCSPGDPLVLERPPPRWSSNSPYS 36 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R R++SCSPGDPLV PPR SS+ S Sbjct: 29 RERSNSCSPGDPLVLERPPPRWSSNSPYS 57 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.7 bits (71), Expect = 0.21 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = -2 Query: 116 RYIEHATRTHTRP---RADSCSPGDPLV--*TPPRGSSSCSLS 3 RY EH + + R++SCSPGDPLV PPR SS+ S Sbjct: 19 RYFEHFSLVVPKQESIRSNSCSPGDPLVLERPPPRWSSNSPYS 61 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.27 Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R R R++SCSPGDPLV PPR SS+ S Sbjct: 4 RGGARYRSNSCSPGDPLVLERPPPRWSSNSPYS 36 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 32.3 bits (70), Expect = 0.27 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = +1 Query: 13 QLELPRGG--V*TSGSPGLQESARGRV-CVRVACSMYRMLQNLVISS 144 +LEL RGG TSGSPGLQE G+ ++VA S +Q + I+S Sbjct: 69 ELELHRGGGRSRTSGSPGLQEFDGGQTHTIQVAESALAPIQEVAIAS 115 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 32.3 bits (70), Expect = 0.27 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -2 Query: 122 NIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 NI+ + R + ++SCSPGDPLV PPR SS+ S Sbjct: 7 NIQATSYFLRNSSNISSNSCSPGDPLVLERPPPRWSSNSPYS 48 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.27 Identities = 19/31 (61%), Positives = 21/31 (67%), Gaps = 3/31 (9%) Frame = -2 Query: 86 TRPRA-DSCSPGDPLV--*TPPRGSSSCSLS 3 T PRA +SCSPGDPLV PPR SS+ S Sbjct: 6 TMPRASNSCSPGDPLVLERPPPRWSSNSPYS 36 >SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.27 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 5/43 (11%) Frame = -2 Query: 116 RYIEHAT---RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R I+H + R+H ++SCSPGDPLV PPR SS+ S Sbjct: 6 RAIKHGSCHYRSHGTYGSNSCSPGDPLVLERPPPRWSSNSPYS 48 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.3 bits (70), Expect = 0.27 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 9/59 (15%) Frame = -2 Query: 152 LITEDITRFCNIRYI--EHATRTHT-----RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 LI+ +I + +R + EH + T +P ++SCSPGDPLV PPR SS+ S Sbjct: 8 LISANIRQGWELRIVLSEHLPNSKTDINPRKPPSNSCSPGDPLVLERPPPRWSSNSPYS 66 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +P ++SCSPGDPLV PPR SS+ S Sbjct: 45 KPTSNSCSPGDPLVLERPPPRWSSNSPYS 73 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.3 bits (70), Expect = 0.27 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -2 Query: 110 IEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 I H + R +++SCSPGDPLV PPR SS+ S Sbjct: 2 IVHKIQKFYRIQSNSCSPGDPLVLERPPPRWSSNSPYS 39 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.27 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 104 HATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H + R++SCSPGDPLV PPR SS+ S Sbjct: 2 HRSHMEDEIRSNSCSPGDPLVLERPPPRWSSNSPYS 37 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 32.3 bits (70), Expect = 0.27 Identities = 17/29 (58%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R R++SCSPGDPLV PPR SS+ S Sbjct: 320 RVRSNSCSPGDPLVLERPPPRWSSNSPYS 348 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 32.3 bits (70), Expect = 0.27 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = -2 Query: 140 DITRFCNIRYIEHATRTHTRPRA-DSCSPGDPLV--*TPPRGSSSCSLS 3 D T ++Y EH ++ ++ +SCSPGDPLV PPR SS+ S Sbjct: 7 DPTLSRKLQYSEHIIKSRCSCQSSNSCSPGDPLVLERPPPRWSSNSPYS 55 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 32.3 bits (70), Expect = 0.27 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 IEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 ++H R ++SCSPGDPLV PPR SS+ S Sbjct: 60 LKHLRMIENRRGSNSCSPGDPLVLERPPPRWSSNSPYS 97 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H++ ++SCSPGDPLV PPR SS+ S Sbjct: 10 HSQTTSNSCSPGDPLVLERPPPRWSSNSPYS 40 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.36 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 122 NIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 N IE + R++SCSPGDPLV PPR SS+ S Sbjct: 6 NYLRIEFLSNPPKNLRSNSCSPGDPLVLERPPPRWSSNSPYS 47 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.9 bits (69), Expect = 0.36 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 98 TRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T +P ++SCSPGDPLV PPR SS+ S Sbjct: 57 TILEVQPLSNSCSPGDPLVLERPPPRWSSNSPYS 90 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHE 79 +WSS AA +LVDPPGCRN E Sbjct: 3 NWSSTAVAAALELVDPPGCRNSME 26 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.36 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T R++SCSPGDPLV PPR SS+ S Sbjct: 2 TSNRSNSCSPGDPLVLERPPPRWSSNSPYS 31 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.9 bits (69), Expect = 0.36 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 125 CNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 C + T H P ++SCSPGDPLV PPR SS+ S Sbjct: 40 CTPPLLSPCTPPHLSP-SNSCSPGDPLVLERPPPRWSSNSPYS 81 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.36 Identities = 19/34 (55%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -2 Query: 95 RTHTRP-RADSCSPGDPLV--*TPPRGSSSCSLS 3 R RP R++SCSPGDPLV PPR SS+ S Sbjct: 10 RDPKRPHRSNSCSPGDPLVLERPPPRWSSNSPYS 43 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.9 bits (69), Expect = 0.36 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = -2 Query: 92 THTRPR-ADSCSPGDPLV--*TPPRGSSSCSLS 3 ++ RPR ++SCSPGDPLV PPR SS+ S Sbjct: 12 SNQRPRESNSCSPGDPLVLERPPPRWSSNSPYS 44 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHE 79 +WSS AA +LVDPPGCRN E Sbjct: 3 NWSSTAVAAALELVDPPGCRNSME 26 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = -2 Query: 74 ADSCSPGDPLV--*TPPRGSSSCSLS 3 ++SCSPGDPLV PPR SS+ S Sbjct: 89 SNSCSPGDPLVLERPPPRWSSNSPYS 114 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHEGE 85 +WSS AA +LVDPPGCRN G+ Sbjct: 79 NWSSTAVAAALELVDPPGCRNSIAGK 104 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHEGECV 91 +WSS AA +LVDPPGCRN + V Sbjct: 66 NWSSTAVAAALELVDPPGCRNSMDSRVV 93 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 31.5 bits (68), Expect = 0.48 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -2 Query: 143 EDITRFCNIRYIEHATRTH-TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 ED RF +E T ++SCSPGDPLV PPR SS+ S Sbjct: 238 EDTERFYTAESVEFLRENPVTEYISNSCSPGDPLVLERPPPRWSSNSPYS 287 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 9 PASNSCSPGDPLVLERPPPRWSSNSPYS 36 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 15 PTSNSCSPGDPLVLERPPPRWSSNSPYS 42 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 3/27 (11%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN-RHEGE 85 +WSS AA +LVDPPGCRN H G+ Sbjct: 3 NWSSTAVAAALELVDPPGCRNSMHIGQ 29 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 20 PTSNSCSPGDPLVLERPPPRWSSNSPYS 47 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H +++SCSPGDPLV PPR SS+ S Sbjct: 25 HDHNQSNSCSPGDPLVLERPPPRWSSNSPYS 55 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/25 (64%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNR-HE 79 +WSS AA +LVDPPGCRN HE Sbjct: 3 NWSSTAVAAALELVDPPGCRNSIHE 27 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 31.5 bits (68), Expect = 0.48 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHE 79 +WSS AA +LVDPPGCRN E Sbjct: 3 NWSSTAVAAALELVDPPGCRNSIE 26 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 31.5 bits (68), Expect = 0.48 Identities = 15/24 (62%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHE 79 +WSS AA +LVDPPGCRN E Sbjct: 3 NWSSTAVAAALELVDPPGCRNSIE 26 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 15 RSNSCSPGDPLVLERAPPRWSSNSPYS 41 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H + ++SCSPGDPLV PPR SS+ S Sbjct: 8 HKKSLSNSCSPGDPLVLERPPPRWSSNSPYS 38 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 0.48 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 125 CNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 C +R H + ++SCSPGDPLV PPR SS+ S Sbjct: 14 CRVR--TQIAEKHVKFTSNSCSPGDPLVLERPPPRWSSNSPYS 54 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.5 bits (68), Expect = 0.48 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHEGECV 91 +WSS AA +LVDPPGCRN + V Sbjct: 3 NWSSTAVAAALELVDPPGCRNSIQARSV 30 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 31.5 bits (68), Expect = 0.48 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 113 YIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 Y + T+ P ++SCSPGDPLV PPR SS+ S Sbjct: 33 YTQTPPTTYAEP-SNSCSPGDPLVLERPPPRWSSNSPYS 70 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + R++SCSPGDPLV PPR SS+ S Sbjct: 42 KKRSNSCSPGDPLVLERPPPRWSSNSPYS 70 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + R++SCSPGDPLV PPR SS+ S Sbjct: 1 KTRSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.5 bits (68), Expect = 0.48 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -2 Query: 137 ITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +T C +R + + + R ++SCSPGDPLV PPR SS+ S Sbjct: 5 LTEMCAVR--DTSILSAGRSLSNSCSPGDPLVLERPPPRWSSNSPYS 49 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/26 (61%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -2 Query: 74 ADSCSPGDPLV--*TPPRGSSSCSLS 3 ++SCSPGDPLV TPPR SS+ S Sbjct: 6 SNSCSPGDPLVLERTPPRWSSNSPYS 31 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H + ++SCSPGDPLV PPR SS+ S Sbjct: 22 HLQAASNSCSPGDPLVLERPPPRWSSNSPYS 52 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R +++SCSPGDPLV PPR SS+ S Sbjct: 2 RSKSNSCSPGDPLVLERPPPRWSSNSPYS 30 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + R++SCSPGDPLV PPR SS+ S Sbjct: 5 KSRSNSCSPGDPLVLERPPPRWSSNSPYS 33 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +P ++SCSPGDPLV PPR SS+ S Sbjct: 95 QPPSNSCSPGDPLVLERPPPRWSSNSPYS 123 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/29 (55%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R +++SCSPGDPLV PPR SS+ S Sbjct: 26 RAKSNSCSPGDPLVLERPPPRWSSNSPYS 54 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.5 bits (68), Expect = 0.48 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 TR ++SCSPGDPLV PPR SS+ S Sbjct: 61 TRGGSNSCSPGDPLVLERPPPRWSSNSPYS 90 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.48 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 18 PASNSCSPGDPLVLERPPPRWSSNSPYS 45 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 31.5 bits (68), Expect = 0.48 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRNRHEG 82 +WSS AA +LVDPPGCRN G Sbjct: 90 NWSSTAVAAALELVDPPGCRNSITG 114 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 16 PPSNSCSPGDPLVLERPPPRWSSNSPYS 43 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 381 RSNSCSPGDPLVLERPPPRWSSNSPYS 407 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 10 RSNSCSPGDPLVLERPPPRWSSNSPYS 36 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 12 RSNSCSPGDPLVLERPPPRWSSNSPYS 38 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 16 RSNSCSPGDPLVLERPPPRWSSNSPYS 42 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 4 RSNSCSPGDPLVLERPPPRWSSNSPYS 30 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 13 RSNSCSPGDPLVLERPPPRWSSNSPYS 39 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 24 PGSNSCSPGDPLVLERPPPRWSSNSPYS 51 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 23 NWSSTAVAAALELVDPPGCRN 43 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 4 RSNSCSPGDPLVLERPPPRWSSNSPYS 30 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 79 NWSSTAVAAALELVDPPGCRN 99 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 647 NWSSTAVAAALELVDPPGCRN 667 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 31.1 bits (67), Expect = 0.63 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 98 TRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T + T ++SCSPGDPLV PPR SS+ S Sbjct: 110 TASDTNEVSNSCSPGDPLVLERPPPRWSSNSPYS 143 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 31.1 bits (67), Expect = 0.63 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 TR ++SCSPGDPLV PPR SS+ S Sbjct: 181 TRRVSNSCSPGDPLVLERPPPRWSSNSPYS 210 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 16 PLSNSCSPGDPLVLERPPPRWSSNSPYS 43 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 63 RSNSCSPGDPLVLERPPPRWSSNSPYS 89 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 19 PPSNSCSPGDPLVLERPPPRWSSNSPYS 46 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 20 NWSSTAVAAALELVDPPGCRN 40 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 16 RSNSCSPGDPLVLERPPPRWSSNSPYS 42 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 60 NWSSTAVAAALELVDPPGCRN 80 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 558 RSNSCSPGDPLVLERPPPRWSSNSPYS 584 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 15 RSNSCSPGDPLVLERPPPRWSSNSPYS 41 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 26 RSNSCSPGDPLVLERPPPRWSSNSPYS 52 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 31 RSNSCSPGDPLVLERPPPRWSSNSPYS 57 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 8 RSNSCSPGDPLVLERPPPRWSSNSPYS 34 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 58 NWSSTAVAAALELVDPPGCRN 78 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 25 RSNSCSPGDPLVLERPPPRWSSNSPYS 51 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.1 bits (67), Expect = 0.63 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = -2 Query: 110 IEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 IE+++ T ++SCSPGDPLV PPR SS+ S Sbjct: 21 IENSSLKPTFSISNSCSPGDPLVLERPPPRWSSNSPYS 58 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 92 RSNSCSPGDPLVLERPPPRWSSNSPYS 118 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 20 RSNSCSPGDPLVLERPPPRWSSNSPYS 46 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 54 RSNSCSPGDPLVLERPPPRWSSNSPYS 80 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 7 RSNSCSPGDPLVLERPPPRWSSNSPYS 33 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 64 RSNSCSPGDPLVLERPPPRWSSNSPYS 90 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.63 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 98 TRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 TR T ++SCSPGDPLV PPR SS+ S Sbjct: 18 TRESTPFGSNSCSPGDPLVLERPPPRWSSNSPYS 51 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 29 RSNSCSPGDPLVLERPPPRWSSNSPYS 55 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 16 RSNSCSPGDPLVLERPPPRWSSNSPYS 42 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 26 RSNSCSPGDPLVLERPPPRWSSNSPYS 52 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 138 PGSNSCSPGDPLVLERPPPRWSSNSPYS 165 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 24 RSNSCSPGDPLVLERPPPRWSSNSPYS 50 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 45 RSNSCSPGDPLVLERPPPRWSSNSPYS 71 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 59 RSNSCSPGDPLVLERPPPRWSSNSPYS 85 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 16 RSNSCSPGDPLVLERPPPRWSSNSPYS 42 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 25 RSNSCSPGDPLVLERPPPRWSSNSPYS 51 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T+ ++SCSPGDPLV PPR SS+ S Sbjct: 19 TKQSSNSCSPGDPLVLERPPPRWSSNSPYS 48 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 7 RSNSCSPGDPLVLERPPPRWSSNSPYS 33 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 14 RSNSCSPGDPLVLERPPPRWSSNSPYS 40 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 8 RSNSCSPGDPLVLERPPPRWSSNSPYS 34 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.1 bits (67), Expect = 0.63 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = -2 Query: 122 NIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 NIR A ++ ++SCSPGDPLV PPR SS+ S Sbjct: 12 NIRISVLALKSRPMLVSNSCSPGDPLVLERPPPRWSSNSPYS 53 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 55 RSNSCSPGDPLVLERPPPRWSSNSPYS 81 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 14 RSNSCSPGDPLVLERPPPRWSSNSPYS 40 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 24 PGSNSCSPGDPLVLERPPPRWSSNSPYS 51 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 54 RSNSCSPGDPLVLERPPPRWSSNSPYS 80 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 3 RSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 8 RSNSCSPGDPLVLERPPPRWSSNSPYS 34 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 90 NWSSTAVAAALELVDPPGCRN 110 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 19 RSNSCSPGDPLVLERPPPRWSSNSPYS 45 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 1 RSNSCSPGDPLVLERPPPRWSSNSPYS 27 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 31.1 bits (67), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = +2 Query: 14 SWSSRG--AASKLVDPPGCRN 70 +WSS AA +LVDPPGCRN Sbjct: 3 NWSSTAVAAALELVDPPGCRN 23 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 5 RSNSCSPGDPLVLERPPPRWSSNSPYS 31 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 5 RSNSCSPGDPLVLERPPPRWSSNSPYS 31 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 R++SCSPGDPLV PPR SS+ S Sbjct: 21 RSNSCSPGDPLVLERPPPRWSSNSPYS 47 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.7 bits (66), Expect = 0.84 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 29 PVSNSCSPGDPLVLERPPPRWSSNSPYS 56 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 0.84 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -1 Query: 84 SPSCRFLQPGGSTSLDAAPRELQL 13 SP+ FLQPGGSTS AA ++L Sbjct: 8 SPNIEFLQPGGSTSSRAAATAVEL 31 >SB_40301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2653 Score = 30.7 bits (66), Expect = 0.84 Identities = 18/27 (66%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = +1 Query: 13 QLELPRGG--V*TSGSPGLQESARGRV 87 +LEL RGG TSGSPGLQE GRV Sbjct: 2498 ELELHRGGGRSRTSGSPGLQEFDGGRV 2524 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 0.84 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +R ++SCSPGDPLV PPR SS+ S Sbjct: 50 SRSASNSCSPGDPLVLERPPPRWSSNSPYS 79 >SB_28769| Best HMM Match : ig (HMM E-Value=1e-06) Length = 213 Score = 30.7 bits (66), Expect = 0.84 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +1 Query: 13 QLELPRGG--V*TSGSPGLQESARGRVCVRVACSMYRMLQNLVISSV 147 +LEL RGG TSGSPGLQE + +R ++ M N+++ SV Sbjct: 2 ELELHRGGGRSRTSGSPGLQEFDMDNLLIRK--NINGMFHNILLDSV 46 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.7 bits (66), Expect = 0.84 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 2 PVSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 30.7 bits (66), Expect = 0.84 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 155 LLITEDITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +++T +T + + H ++SCSPGDPLV PPR SS+ S Sbjct: 85 IMMTMVMTMVLMMTMVSRNIPDHYSSPSNSCSPGDPLVLERPPPRWSSNSPYS 137 >SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 0.84 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T+ ++SCSPGDPLV PPR SS+ S Sbjct: 2 TKKGSNSCSPGDPLVLERPPPRWSSNSPYS 31 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.7 bits (66), Expect = 0.84 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -2 Query: 101 ATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 ATR ++SCSPGDPLV PPR SS+ S Sbjct: 17 ATRVRFPLISNSCSPGDPLVLERPPPRWSSNSPYS 51 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 30.7 bits (66), Expect = 0.84 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -2 Query: 80 PRADSCSPGDPLV--*TPPRGSSSCSLS 3 P ++SCSPGDPLV PPR SS+ S Sbjct: 58 PVSNSCSPGDPLVLERPPPRWSSNSPYS 85 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 30.7 bits (66), Expect = 0.84 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +T+ ++SCSPGDPLV PPR SS+ S Sbjct: 351 KTNEASASNSCSPGDPLVLERPPPRWSSNSPYS 383 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 30.7 bits (66), Expect = 0.84 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 98 TRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T T + ++SCSPGDPLV PPR SS+ S Sbjct: 3 TNTLAQITSNSCSPGDPLVLERPPPRWSSNSPYS 36 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 30.7 bits (66), Expect = 0.84 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -2 Query: 113 YIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSS 15 Y+ THT ++SCSPGDPLV PPR SS+ Sbjct: 41 YLGEMEVTHT---SNSCSPGDPLVLERPPPRWSSN 72 >SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 146 Score = 30.7 bits (66), Expect = 0.84 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H ++SCSPGDPLV PPR SS+ S Sbjct: 18 HNMAGSNSCSPGDPLVLERPPPRWSSNSPYS 48 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 110 IEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 I H + ++SCSPGDPLV PPR SS+ S Sbjct: 90 ISHRQTNKSLKISNSCSPGDPLVLERPPPRWSSNSPYS 127 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +T + ++SCSPGDPLV PPR SS+ S Sbjct: 14 KTRKKIPSNSCSPGDPLVLERPPPRWSSNSPYS 46 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -1 Query: 81 PSCRFLQPGGSTSLDAAPRELQL 13 PS FLQPGGSTS AA ++L Sbjct: 23 PSIEFLQPGGSTSSRAAATAVEL 45 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R ++SCSPGDPLV PPR SS+ S Sbjct: 15 RTTSNSCSPGDPLVLERPPPRWSSNSPYS 43 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R ++SCSPGDPLV PPR SS+ S Sbjct: 31 RKTSNSCSPGDPLVLERPPPRWSSNSPYS 59 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T+ ++SCSPGDPLV PPR SS+ S Sbjct: 10 TKVLSNSCSPGDPLVLERPPPRWSSNSPYS 39 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R ++SCSPGDPLV PPR SS+ S Sbjct: 20 RRESNSCSPGDPLVLERPPPRWSSNSPYS 48 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H ++SCSPGDPLV PPR SS+ S Sbjct: 10 HVLNSSNSCSPGDPLVLERPPPRWSSNSPYS 40 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.3 bits (65), Expect = 1.1 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 IEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 I H + +++SCSPGDPLV PPR SS+ S Sbjct: 13 IGHVVYINIIRQSNSCSPGDPLVLERPPPRWSSNSPYS 50 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = -2 Query: 116 RYIEHATRTH-TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R + TR ++ ++SCSPGDPLV PPR SS+ S Sbjct: 103 RCVSDVTRALVSKAESNSCSPGDPLVLERPPPRWSSNSPYS 143 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 113 YIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 YI + + R ++SCSPGDPLV PPR SS+ S Sbjct: 8 YIREKLQGYIR-ESNSCSPGDPLVLERPPPRWSSNSPYS 45 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + +++SCSPGDPLV PPR SS+ S Sbjct: 3 KKKSNSCSPGDPLVLERPPPRWSSNSPYS 31 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 122 NIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 N R + R ++SCSPGDPLV PPR SS+ S Sbjct: 237 NRRVLPSLVRATAINASNSCSPGDPLVLERPPPRWSSNSPYS 278 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T ++SCSPGDPLV PPR SS+ S Sbjct: 69 TATESNSCSPGDPLVLERPPPRWSSNSPYS 98 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H ++SCSPGDPLV PPR SS+ S Sbjct: 3 HVSLSSNSCSPGDPLVLERPPPRWSSNSPYS 33 >SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -2 Query: 89 HTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + R ++SCSPGDPLV PPR SS+ S Sbjct: 3 NVRHTSNSCSPGDPLVLERPPPRWSSNSPYS 33 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + +++SCSPGDPLV PPR SS+ S Sbjct: 16 KAKSNSCSPGDPLVLERPPPRWSSNSPYS 44 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T+ ++SCSPGDPLV PPR SS+ S Sbjct: 35 TQMASNSCSPGDPLVLERPPPRWSSNSPYS 64 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +R ++SCSPGDPLV PPR SS+ S Sbjct: 16 SRVSSNSCSPGDPLVLERPPPRWSSNSPYS 45 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R + ++SCSPGDPLV PPR SS+ S Sbjct: 27 RPENKALSNSCSPGDPLVLERPPPRWSSNSPYS 59 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -2 Query: 104 HATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H + + ++SCSPGDPLV PPR SS+ S Sbjct: 21 HIQKKGAKEISNSCSPGDPLVLERPPPRWSSNSPYS 56 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -2 Query: 158 NLLITEDITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 N++ + +T + N + H ++SCSPGDPLV PPR SS+ S Sbjct: 4 NIIYSHRLTNYSNC-----LNKCHNIVISNSCSPGDPLVLERPPPRWSSNSPYS 52 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -2 Query: 86 TRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 T ++SCSPGDPLV PPR SS+ S Sbjct: 17 TNKSSNSCSPGDPLVLERPPPRWSSNSPYS 46 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R ++SCSPGDPLV PPR SS+ S Sbjct: 51 RVASNSCSPGDPLVLERPPPRWSSNSPYS 79 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -1 Query: 84 SPSCRFLQPGGSTSLDAAPRELQL 13 SP FLQPGGSTS AA ++L Sbjct: 22 SPMIEFLQPGGSTSSRAAATAVEL 45 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -2 Query: 104 HATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 H + ++SCSPGDPLV PPR SS+ S Sbjct: 53 HMDEPTAKKLSNSCSPGDPLVLERPPPRWSSNSPYS 88 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R ++ ++SCSPGDPLV PPR SS+ S Sbjct: 14 RRGSQTASNSCSPGDPLVLERPPPRWSSNSPYS 46 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R +++SCSPGDPLV PPR SS+ S Sbjct: 17 RPSVASQSNSCSPGDPLVLERPPPRWSSNSPYS 49 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/29 (55%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = -2 Query: 83 RPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R ++SCSPGDPLV PPR SS+ S Sbjct: 16 RVTSNSCSPGDPLVLERPPPRWSSNSPYS 44 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 +++SCSPGDPLV PPR SS+ S Sbjct: 22 KSNSCSPGDPLVLERPPPRWSSNSPYS 48 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -2 Query: 74 ADSCSPGDPLV--*TPPRGSSSCSLS 3 ++SCSPGDPLV +PPR SS+ S Sbjct: 43 SNSCSPGDPLVLERSPPRWSSNSPYS 68 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 +++SCSPGDPLV PPR SS+ S Sbjct: 71 KSNSCSPGDPLVLERPPPRWSSNSPYS 97 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 110 IEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 +EH TR + SCSPGDPLV PPR SS+ S Sbjct: 730 LEH-TRELEEDGSYSCSPGDPLVLERPPPRWSSNSPYS 766 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 +++SCSPGDPLV PPR SS+ S Sbjct: 21 KSNSCSPGDPLVLERPPPRWSSNSPYS 47 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -2 Query: 95 RTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 R R ++SCSPGDPLV PPR SS+ S Sbjct: 17 RDTDRHLSNSCSPGDPLVLERPPPRWSSNSPYS 49 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 +++SCSPGDPLV PPR SS+ S Sbjct: 20 KSNSCSPGDPLVLERPPPRWSSNSPYS 46 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/37 (51%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -2 Query: 107 EHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 EH T R ++SCSPGDPLV PPR SS+ S Sbjct: 23 EHVTICSYRI-SNSCSPGDPLVLERPPPRWSSNSPYS 58 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/26 (57%), Positives = 19/26 (73%), Gaps = 2/26 (7%) Frame = -2 Query: 74 ADSCSPGDPLV--*TPPRGSSSCSLS 3 ++SCSPGDPLV +PPR SS+ S Sbjct: 36 SNSCSPGDPLVLERSPPRWSSNSPYS 61 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -2 Query: 119 IRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 + Y+ + ++SCSPGDPLV PPR SS+ S Sbjct: 72 VEYLHESVPKSEPLSSNSCSPGDPLVLERPPPRWSSNSPYS 112 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 +++SCSPGDPLV PPR SS+ S Sbjct: 14 KSNSCSPGDPLVLERPPPRWSSNSPYS 40 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -2 Query: 167 FCINLLITEDITRFCNIRYIEHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 F ++ I +T + +++ ++ T ++SCSPGDPLV PPR SS+ S Sbjct: 13 FGVDRQILRALTCYTSLQVLD-LDALDTTQGSNSCSPGDPLVLERPPPRWSSNSPYS 68 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = -2 Query: 77 RADSCSPGDPLV--*TPPRGSSSCSLS 3 +++SCSPGDPLV PPR SS+ S Sbjct: 3 KSNSCSPGDPLVLERPPPRWSSNSPYS 29 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = -2 Query: 89 HTRPRA-DSCSPGDPLV--*TPPRGSSSCSLS 3 H + R+ +SCSPGDPLV PPR SS+ S Sbjct: 1 HLKKRSSNSCSPGDPLVLERPPPRWSSNSPYS 32 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -2 Query: 107 EHATRTHTRPRADSCSPGDPLV--*TPPRGSSSCSLS 3 E T ++SCSPGDPLV PPR SS+ S Sbjct: 217 EQRNYTQLLESSNSCSPGDPLVLERPPPRWSSNSPYS 253 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,951,636 Number of Sequences: 59808 Number of extensions: 358843 Number of successful extensions: 2308 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2295 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -