BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L19 (555 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 27 0.55 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 1.7 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 26.6 bits (56), Expect = 0.55 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 277 TLCTVYLYTKCNILKYYIQEIFISVRVLPL 366 T+ YL+T+CN L Y+ +++R++ L Sbjct: 20 TVYYYYLFTQCNPLSTYLYRTILALRLVTL 49 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.0 bits (52), Expect = 1.7 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 Query: 97 VACSMYRMLQNLVISSVIRRF 159 + CS+YR+L L++S++ RF Sbjct: 565 IFCSVYRILGVLILSALANRF 585 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,815 Number of Sequences: 2352 Number of extensions: 11152 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -