BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L16 (520 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC035609-1|AAH35609.1| 1195|Homo sapiens myotubularin related pr... 29 9.8 AF264717-1|AAF72539.1| 1195|Homo sapiens FYVE domain-containing ... 29 9.8 AB014547-1|BAA31622.2| 1195|Homo sapiens KIAA0647 protein protein. 29 9.8 >BC035609-1|AAH35609.1| 1195|Homo sapiens myotubularin related protein 4 protein. Length = 1195 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 189 AEDKKLLG-DSQCGYENNIPMVCCPISNACKTPDD 290 A+ +LG S+C ++++ VC P S AC+TP D Sbjct: 793 AQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLD 827 >AF264717-1|AAF72539.1| 1195|Homo sapiens FYVE domain-containing dual specificity protein phosphatase FYVE-DSP2 protein. Length = 1195 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 189 AEDKKLLG-DSQCGYENNIPMVCCPISNACKTPDD 290 A+ +LG S+C ++++ VC P S AC+TP D Sbjct: 793 AQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLD 827 >AB014547-1|BAA31622.2| 1195|Homo sapiens KIAA0647 protein protein. Length = 1195 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +3 Query: 189 AEDKKLLG-DSQCGYENNIPMVCCPISNACKTPDD 290 A+ +LG S+C ++++ VC P S AC+TP D Sbjct: 793 AQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLD 827 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,751,552 Number of Sequences: 237096 Number of extensions: 1337105 Number of successful extensions: 2308 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2308 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -