BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L14 (322 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0216 + 15804110-15804284,15804341-15804351 30 0.47 06_03_0795 - 24683023-24683155,24685853-24686057,24686275-246864... 30 0.47 03_05_0517 - 25118232-25118730,25119002-25119273 28 1.4 03_02_0269 + 7001891-7002212,7003598-7004037 28 1.4 11_04_0321 - 16359390-16359539,16359674-16359746,16360448-163608... 27 2.5 12_02_0219 + 15822050-15824896 27 3.3 09_02_0511 - 10079180-10079355,10079656-10079722,10080144-100801... 27 4.3 07_03_0202 + 15131001-15131047,15131488-15131754,15131913-151319... 27 4.3 03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007,692... 27 4.3 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 27 4.3 12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-10... 26 5.7 07_01_0601 + 4464745-4465010,4465274-4466582 26 5.7 03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390,692... 26 5.7 02_05_0005 - 24890239-24891419,24891524-24891694,24891810-24892704 26 5.7 02_01_0138 + 999809-999821,1000456-1001341,1001424-1003221,10037... 26 5.7 12_01_1022 - 10435409-10435564,10435950-10436219,10436820-104371... 26 7.6 04_01_0072 - 784922-785567,785673-786406 26 7.6 03_05_0142 - 21217375-21217518,21217851-21217899,21218191-212182... 26 7.6 >12_02_0216 + 15804110-15804284,15804341-15804351 Length = 61 Score = 29.9 bits (64), Expect = 0.47 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +1 Query: 103 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 225 SG P+ +H V FF+ SN SGNY + G F Sbjct: 12 SGSPAPPYKNHTVAGADGWFFNATSNTTSGNYSDWAAGETF 52 >06_03_0795 - 24683023-24683155,24685853-24686057,24686275-24686443, 24686590-24686775,24686916-24687124,24687197-24687362 Length = 355 Score = 29.9 bits (64), Expect = 0.47 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 130 HYCRPMEHHYCPPRELCLRQPW 65 HYCR +E+ YC + L R+ W Sbjct: 181 HYCRSIENWYCLSKTLAEREAW 202 >03_05_0517 - 25118232-25118730,25119002-25119273 Length = 256 Score = 28.3 bits (60), Expect = 1.4 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +1 Query: 154 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 264 D FF++ P GN T P VD P P + + Sbjct: 37 DWFFTRKGESPQGNISKEETAPTGVDVTDPGRPGRAF 73 >03_02_0269 + 7001891-7002212,7003598-7004037 Length = 253 Score = 28.3 bits (60), Expect = 1.4 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 289 SHHGREGCRIAWVDNWDD*NRR 224 + H R+ R+AW D W D +R+ Sbjct: 62 TEHARQRMRVAWADGWVDGSRK 83 >11_04_0321 - 16359390-16359539,16359674-16359746,16360448-16360845, 16360919-16362673,16362751-16362861,16363745-16363962, 16364088-16364196 Length = 937 Score = 27.5 bits (58), Expect = 2.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 247 YPPKRYDNPLARGGK 291 YPPKRY NP+ G+ Sbjct: 859 YPPKRYSNPVGPAGR 873 >12_02_0219 + 15822050-15824896 Length = 948 Score = 27.1 bits (57), Expect = 3.3 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 5 DNSDTIRQ*KLSC-FSSSPYWPWLPQTEFTWWTIVV 109 D D +R+ ++ C F+ P WPWL ++ T+V+ Sbjct: 269 DFGDPLRKHEMHCRFTQGPPWPWLAVAS-SYGTLVI 303 >09_02_0511 - 10079180-10079355,10079656-10079722,10080144-10080181, 10080255-10080336 Length = 120 Score = 26.6 bits (56), Expect = 4.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 91 VVDNSGVPSDGNSDHVVIANPDPFFSQPSNG 183 +++N+G S GN ++ N PFF SNG Sbjct: 57 ILNNAGATSKGNYALILPVNEFPFFLVYSNG 87 >07_03_0202 + 15131001-15131047,15131488-15131754,15131913-15131940, 15132120-15132179,15132570-15132696,15132907-15133724 Length = 448 Score = 26.6 bits (56), Expect = 4.3 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = +1 Query: 79 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGP----SGNYEPISTGPAFVDFN 237 NR+HV+D + V I+ PDP +P + P S P + +F +FN Sbjct: 19 NRLHVLDPPCPSPVAAGEKVSISAPDPISHKPVSRPKVPVSDGNAPNAISKSFFNFN 75 >03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007, 6926093-6926368,6926460-6926678,6926758-6926926, 6927208-6927382,6927489-6927600,6929566-6929820 Length = 604 Score = 26.6 bits (56), Expect = 4.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 91 VVDNSGVPSDGNSDHVVIANPDPFFSQP 174 V++N +P N HVV+ANP P P Sbjct: 248 VLENCQLPH-ANHGHVVLANPSPILFYP 274 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 26.6 bits (56), Expect = 4.3 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +1 Query: 103 SGVPSD-GNSDHVVIANPDPFF-SQPSNGPSGNYEPIST 213 SG PS GN+ + ++P PF S PS+G SGNY + T Sbjct: 464 SGSPSHRGNAG--MKSSPSPFAPSGPSSGGSGNYGRLPT 500 >12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-106310, 106787-106825,107026-107109,107193-107241,107331-107422, 107680-107809,107906-107982,108058-109676,110024-110221, 110287-110825 Length = 1109 Score = 26.2 bits (55), Expect = 5.7 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = +1 Query: 157 PFFSQPSNGPSG------NYEPISTGPAFVDFNHPNYPP 255 P FS P+ P+G ++E ++ P F N PN PP Sbjct: 875 PGFSAPARVPTGFSSGFSSHEGLNPPPGFSSHNGPNPPP 913 >07_01_0601 + 4464745-4465010,4465274-4466582 Length = 524 Score = 26.2 bits (55), Expect = 5.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 127 SDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 222 SDH V+ P PF P++ + + PI T PA Sbjct: 50 SDHFVLT-PPPFQITPTSIQNSTWLPIPTSPA 80 >03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390, 6921473-6921691,6921795-6921963,6922248-6922422, 6922490-6922601,6923343-6923573 Length = 522 Score = 26.2 bits (55), Expect = 5.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 91 VVDNSGVPSDGNSDHVVIANPDPFFSQP 174 V++N +P N HV++ANP P P Sbjct: 240 VLENCQLPHP-NHGHVILANPSPILCYP 266 >02_05_0005 - 24890239-24891419,24891524-24891694,24891810-24892704 Length = 748 Score = 26.2 bits (55), Expect = 5.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 285 TTGERVVVSLGWIIGMIEIDERRSSAYGFIISAR 184 +TG +V + L W++G E R +A G++ +R Sbjct: 233 STGGKVPLVLDWVVGKKTCREARRNATGYMCVSR 266 >02_01_0138 + 999809-999821,1000456-1001341,1001424-1003221, 1003716-1003805,1004034-1004111,1004513-1004518, 1004849-1004958,1005174-1005369 Length = 1058 Score = 26.2 bits (55), Expect = 5.7 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 126 IAVRWNTTIVHHVNSV 79 IA RW T ++HHVNS+ Sbjct: 507 IAGRWLTQMLHHVNSL 522 >12_01_1022 - 10435409-10435564,10435950-10436219,10436820-10437125, 10437932-10438057,10439825-10439893,10440443-10440487, 10440717-10440776,10441527-10441589,10442186-10442266, 10442494-10442916 Length = 532 Score = 25.8 bits (54), Expect = 7.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 124 NSDHVVIANPDPFFSQPSNGPSGNYEPIS-TGPAFVDFNHPNYPP 255 N HV P P +S P G Y P G V N P YPP Sbjct: 357 NEHHVPFIAPSPSYSAGMLPPQGMYPPPEWNGYHQVPLN-PYYPP 400 >04_01_0072 - 784922-785567,785673-786406 Length = 459 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +1 Query: 160 FFSQPSNGP--SGNYEPISTGPAFVD 231 FFS+PS GP SGN++ + +D Sbjct: 66 FFSRPSKGPTVSGNFDYLPCSSCIID 91 >03_05_0142 - 21217375-21217518,21217851-21217899,21218191-21218258, 21218368-21218413,21218548-21218641,21218775-21218837, 21219018-21219171,21219414-21219476,21219568-21219681, 21219779-21219844,21220813-21220870,21221859-21221932, 21222045-21222110,21223139-21223187,21223483-21223550, 21223660-21223705,21223908-21224001,21224117-21224179, 21224290-21224412,21224503-21224536,21224906-21224968, 21225825-21225911,21226293-21226370 Length = 587 Score = 25.8 bits (54), Expect = 7.6 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +1 Query: 154 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPL 276 +PF + S G S S G + + P+ PP + +PL Sbjct: 298 NPFADKASKGGSAGQSSYSGGAFYTTQSRPSAPPATHLSPL 338 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,348,003 Number of Sequences: 37544 Number of extensions: 188018 Number of successful extensions: 523 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 411066120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -