BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L14 (322 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF560748-1|ABQ59058.1| 490|Homo sapiens SUSD4 protein protein. 28 5.4 AY358495-1|AAQ88859.1| 490|Homo sapiens YHGM196 protein. 28 5.4 AL359979-1|CAI12801.1| 490|Homo sapiens sushi domain containing... 28 5.4 AL359733-2|CAH73991.1| 490|Homo sapiens sushi domain containing... 28 5.4 AL353807-3|CAI13211.2| 2964|Homo sapiens ash1 (absent, small, or... 28 5.4 AL353807-2|CAI13212.1| 2969|Homo sapiens ash1 (absent, small, or... 28 5.4 AL139410-7|CAI12716.2| 2964|Homo sapiens ash1 (absent, small, or... 28 5.4 AL139410-6|CAI12722.1| 2969|Homo sapiens ash1 (absent, small, or... 28 5.4 AK097637-1|BAC05127.1| 177|Homo sapiens protein ( Homo sapiens ... 28 5.4 AF257305-1|AAF68983.1| 2969|Homo sapiens ASH1 protein. 28 5.4 AB209068-1|BAD92305.1| 636|Homo sapiens ash1 (absent, small, or... 28 5.4 AB037841-1|BAA92658.1| 1349|Homo sapiens KIAA1420 protein protein. 28 5.4 X67910-1|CAA48108.1| 129|Homo sapiens Ig variable region (VDJ) ... 28 7.2 AL138762-3|CAH70950.1| 1173|Homo sapiens chromosome 10 open read... 27 9.5 AL138762-2|CAH70949.1| 1186|Homo sapiens chromosome 10 open read... 27 9.5 AL133215-19|CAI10933.1| 1173|Homo sapiens chromosome 10 open rea... 27 9.5 AL133215-18|CAI10932.1| 1186|Homo sapiens chromosome 10 open rea... 27 9.5 AK124693-1|BAC85927.1| 206|Homo sapiens protein ( Homo sapiens ... 27 9.5 AK054724-1|BAB70799.1| 189|Homo sapiens protein ( Homo sapiens ... 27 9.5 AK001374-1|BAA91657.1| 498|Homo sapiens protein ( Homo sapiens ... 27 9.5 AF460991-1|AAN84475.1| 1173|Homo sapiens C10ORF6 protein. 27 9.5 >EF560748-1|ABQ59058.1| 490|Homo sapiens SUSD4 protein protein. Length = 490 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 41 CFSSSPYWPWLPQTEFTWWTIVVFHRTAIV 130 C S WP +T T W IV F T+++ Sbjct: 302 CIKSEQTWPSTHETLLTTWKIVAFTATSVL 331 >AY358495-1|AAQ88859.1| 490|Homo sapiens YHGM196 protein. Length = 490 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 41 CFSSSPYWPWLPQTEFTWWTIVVFHRTAIV 130 C S WP +T T W IV F T+++ Sbjct: 304 CIKSEQTWPSTHETLLTTWKIVAFTATSVL 333 >AL359979-1|CAI12801.1| 490|Homo sapiens sushi domain containing 4 protein. Length = 490 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 41 CFSSSPYWPWLPQTEFTWWTIVVFHRTAIV 130 C S WP +T T W IV F T+++ Sbjct: 302 CIKSEQTWPSTHETLLTTWKIVAFTATSVL 331 >AL359733-2|CAH73991.1| 490|Homo sapiens sushi domain containing 4 protein. Length = 490 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 41 CFSSSPYWPWLPQTEFTWWTIVVFHRTAIV 130 C S WP +T T W IV F T+++ Sbjct: 302 CIKSEQTWPSTHETLLTTWKIVAFTATSVL 331 >AL353807-3|CAI13211.2| 2964|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2964 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 109 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 231 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AL353807-2|CAI13212.1| 2969|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2969 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 109 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 231 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AL139410-7|CAI12716.2| 2964|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2964 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 109 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 231 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AL139410-6|CAI12722.1| 2969|Homo sapiens ash1 (absent, small, or homeotic)-like (Drosophila) protein. Length = 2969 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 109 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 231 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AK097637-1|BAC05127.1| 177|Homo sapiens protein ( Homo sapiens cDNA FLJ40318 fis, clone TESTI2030556. ). Length = 177 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 35 LSCFSSSPYWPWLPQTEF 88 L+CF P+WP++PQT F Sbjct: 72 LACFLQ-PWWPFIPQTRF 88 >AF257305-1|AAF68983.1| 2969|Homo sapiens ASH1 protein. Length = 2969 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 109 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 231 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1093 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1129 >AB209068-1|BAD92305.1| 636|Homo sapiens ash1 (absent, small, or homeotic)-like variant protein. Length = 636 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 109 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 231 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 384 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 420 >AB037841-1|BAA92658.1| 1349|Homo sapiens KIAA1420 protein protein. Length = 1349 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 109 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVD 231 +PS +S ++ P P SQ S+G SG P+S+ FV+ Sbjct: 1097 LPSSASSSEIL---PSPICSQ-SSGTSGGQSPVSSDAGFVE 1133 >X67910-1|CAA48108.1| 129|Homo sapiens Ig variable region (VDJ) protein. Length = 129 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 38 SCFSSSPYWPWLPQTEFTWWTIVVF 112 S S++ YW WLPQ + W + +F Sbjct: 36 SISSTNYYWGWLPQGKGLEWIVSIF 60 >AL138762-3|CAH70950.1| 1173|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1173 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 44 FSSSPYWPWLP 76 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AL138762-2|CAH70949.1| 1186|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1186 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 44 FSSSPYWPWLP 76 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AL133215-19|CAI10933.1| 1173|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1173 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 44 FSSSPYWPWLP 76 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AL133215-18|CAI10932.1| 1186|Homo sapiens chromosome 10 open reading frame 6 protein. Length = 1186 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 44 FSSSPYWPWLP 76 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 >AK124693-1|BAC85927.1| 206|Homo sapiens protein ( Homo sapiens cDNA FLJ42703 fis, clone BRAMY3005932, moderately similar to Diacylglycerol kinase, zeta (EC 2.7.1.107). ). Length = 206 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 133 GHYCRPMEHHYCP 95 GH C P+ H YCP Sbjct: 90 GHICHPLGHPYCP 102 >AK054724-1|BAB70799.1| 189|Homo sapiens protein ( Homo sapiens cDNA FLJ30162 fis, clone BRACE2000565. ). Length = 189 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 145 ANPDPFFSQPSNGPSGNYEPISTGPAFV-DFNHPNYPPKRYDNPLARGGK 291 ++PD F S SN S + P+S P + + +++ NPL +G K Sbjct: 139 SSPDSFASTCSNSNSNSSSPVSLKPEEEHQTDEKQFQIEKWQNPLLQGTK 188 >AK001374-1|BAA91657.1| 498|Homo sapiens protein ( Homo sapiens cDNA FLJ10512 fis, clone NT2RP2000658. ). Length = 498 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 44 FSSSPYWPWLP 76 FS SP WPW+P Sbjct: 165 FSDSPVWPWIP 175 >AF460991-1|AAN84475.1| 1173|Homo sapiens C10ORF6 protein. Length = 1173 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 44 FSSSPYWPWLP 76 FS SP WPW+P Sbjct: 840 FSDSPVWPWIP 850 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,933,599 Number of Sequences: 237096 Number of extensions: 1049652 Number of successful extensions: 2601 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2601 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1569468906 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -