BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L14 (322 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.23 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 28 1.2 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 27 2.1 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 27 2.1 At1g14700.1 68414.m01757 purple acid phosphatase, putative conta... 27 2.8 At4g24150.1 68417.m03465 expressed protein ; expression supporte... 26 4.9 At1g05460.1 68414.m00555 RNA helicase SDE3 (SDE3) identical to R... 26 4.9 At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 ... 26 6.5 At5g45520.1 68418.m05591 hypothetical protein 26 6.5 At4g15393.1 68417.m02352 cytochrome P450 family protein similar ... 26 6.5 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 26 6.5 At5g16570.1 68418.m01939 glutamine synthetase, putative similar ... 25 8.6 At5g07400.1 68418.m00847 forkhead-associated domain-containing p... 25 8.6 At1g58440.1 68414.m06648 squalene monooxygenase, putative / squa... 25 8.6 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.7 bits (66), Expect = 0.23 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 139 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPLARGG 288 ++A P P+ P+ GP P+S+ PA N+P Y P GG Sbjct: 245 MMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGG 294 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 151 PDPFFSQPSNGPSG--NYEPISTGPAFVDFNHPNYPPKRYDNPLAR 282 P P S P N P ++ P + P+ +N P PP YD P R Sbjct: 357 PYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGR 402 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 27.5 bits (58), Expect = 2.1 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 172 PSNGPSGNYEPISTGPAFVDFNHP-NYPPKRYDNP 273 PS+ PS ++ P TGP+ + HP ++ P D P Sbjct: 236 PSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPP 270 Score = 25.8 bits (54), Expect = 6.5 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 148 NPDPFFSQPSNGPSGNYEPISTGP 219 NP+P++S P + P+ + S+ P Sbjct: 316 NPEPYYSSPHSAPAPSSTSFSSAP 339 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 27.5 bits (58), Expect = 2.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 11 SDTIRQ*KLSCFSSSPYWPWLP 76 S I + + SC SSP+ PW+P Sbjct: 96 SKIIEEKRYSCIISSPFTPWVP 117 >At1g14700.1 68414.m01757 purple acid phosphatase, putative contains Pfam profile: PF00149 calcineurin-like phosphoesterase; similar to purple acid phosphatase (GI:20257479) [Arabidopsis thaliana] Length = 366 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 117 RWNTTIVHHVNSVCGSHGQYGEEEKH 40 +W I HH G HG E EKH Sbjct: 239 KWKIVIGHHTIKSAGHHGNTIELEKH 264 >At4g24150.1 68417.m03465 expressed protein ; expression supported by MPSS Length = 493 Score = 26.2 bits (55), Expect = 4.9 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +1 Query: 79 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 225 N+ + +SG+ + S + DPFFS S+G G AF Sbjct: 102 NQAYTSSHSGMFTPAGSGSAAVTVADPFFSLSSSGEMRRSMNEDAGAAF 150 >At1g05460.1 68414.m00555 RNA helicase SDE3 (SDE3) identical to RNA helicase SDE3 [Arabidopsis thaliana] GI:13811296 Length = 1002 Score = 26.2 bits (55), Expect = 4.9 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +1 Query: 103 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHP 243 SG SD + F ++G SG Y P GP V P Sbjct: 4 SGYKSDDEYSVIADKGEIGFIDYQNDGSSGCYNPFDEGPVVVSVPFP 50 >At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 (SCL11) identical to cDNA scarecrow-like 11 (SCL11) mRNA, partial cds gi:4580526 Length = 172 Score = 25.8 bits (54), Expect = 6.5 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +1 Query: 100 NSGVPSDGNSD--HVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNP 273 N G PS +S+ + P+ +PS G+ + + + N PN P+ +D P Sbjct: 82 NGGNPSSSSSNGGKKSFSEPESSKVEPSGETDGDLKRKQSEVVSEEQNRPNKSPRSFDKP 141 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 25.8 bits (54), Expect = 6.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 322 FKIANLYETFTSHHGREGCRIAW 254 FK+ +L E+ T G E +IAW Sbjct: 525 FKVESLMESLTGLQGLESLKIAW 547 >At4g15393.1 68417.m02352 cytochrome P450 family protein similar to Cytochrome P450 90C1 (ROTUNDIFOLIA3) (SP:Q9M066) [Arabidopsis thaliana]; contains Pfam PF00067: Cytochrome P450 Length = 399 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +1 Query: 190 GNYEPISTGPAFVDFNHPNYPPKRYDNPLA 279 G+Y I G F+ + + ++ P++YD+PLA Sbjct: 363 GDYT-IPAGWIFMGYPYVHFNPEKYDDPLA 391 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 148 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 255 +P P S PS+ P + P S P + + P PP Sbjct: 37 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 72 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 148 NPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 255 +P P S PS+ P + P S P + + P PP Sbjct: 86 SPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPP 121 >At5g16570.1 68418.m01939 glutamine synthetase, putative similar to glutamine synthetase, cytosolic isozyme (glutamate-- ammonia ligase) [Alfalfa] SWISS-PROT:P04078 Length = 356 Score = 25.4 bits (53), Expect = 8.6 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 151 PDPFFSQPSNGPSGNYEPISTGPAFVDFNHP-NYPPKRYDNPLARG 285 P P + PS P NY+ STG A D + YP + +P RG Sbjct: 41 PGPV-TDPSQLPKWNYDGSSTGQAPGDDSEVIIYPQAIFKDPFRRG 85 >At5g07400.1 68418.m00847 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1084 Score = 25.4 bits (53), Expect = 8.6 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 100 NSGVPSDGNSDHVVIANPD 156 N+ VP+D N+ V++ NPD Sbjct: 661 NTNVPADPNAVRVLVPNPD 679 >At1g58440.1 68414.m06648 squalene monooxygenase, putative / squalene epoxidase, putative similar to SP|O65404 (SE 1,1), SP|O65402 (SE 1,2) 6566341 dbj AB008021.1 AB008021 Length = 531 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 91 VVDNSGVPSDGNSDHVVIANPDPFFSQP 174 V++N +P N HVV+A+P P P Sbjct: 244 VLENCNLPY-ANHGHVVLADPSPILMYP 270 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,324,617 Number of Sequences: 28952 Number of extensions: 144587 Number of successful extensions: 450 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 350523880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -