BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L12 (532 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 25 0.55 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 25 0.55 AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 23 1.7 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 23 1.7 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 21 6.8 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 21 6.8 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 21 6.8 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 24.6 bits (51), Expect = 0.55 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +1 Query: 1 DGFDITDEVLCSTLGAYDGRVYERLMEQALKSPLNSE 111 DGFD+ E C GA + +V + LKS LN++ Sbjct: 136 DGFDLDWEYPCQRGGADEDKVNFVTLLGELKSALNAK 172 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 24.6 bits (51), Expect = 0.55 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = -1 Query: 271 VFHLFCISNLRNYWQIVFISDLIL*RHFITT*QFKV*LSSSMVLYICGNS 122 +F L C S L+ Y + + + ++FI L+SS+ L++C NS Sbjct: 17 LFLLICDSYLKIYHKEKYRKFCRILKYFIIAIYVLTILTSSVTLHVCFNS 66 Score = 21.4 bits (43), Expect = 5.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 324 LLINVNVSVC*LAYMYKACFIYFVLVI 244 L +V + VC +YMY I+F I Sbjct: 54 LTSSVTLHVCFNSYMYAFTHIFFFFAI 80 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 23.0 bits (47), Expect = 1.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 1 DGFDITDEVLCSTLGAYDGRVYERLMEQALKSPLNSE 111 DGFD+ E C G + +V + LKS LN++ Sbjct: 137 DGFDLDWEYPCQRGGVDEDKVNFVTLLGELKSALNAK 173 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 23.0 bits (47), Expect = 1.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 1 DGFDITDEVLCSTLGAYDGRVYERLMEQALKSPLNSE 111 DGFD+ E C G + +V + LKS LN++ Sbjct: 137 DGFDLDWEYPCQRGGVDEDKVNFVTLLGELKSALNAK 173 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 292 LTDRNVDVYKESSINHVSVI 351 LTD + + K NHV +I Sbjct: 283 LTDEPIAIIKSGDYNHVPMI 302 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 292 LTDRNVDVYKESSINHVSVI 351 LTD + + K NHV +I Sbjct: 283 LTDEPIAIIKSGDYNHVPMI 302 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 6.8 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 292 LTDRNVDVYKESSINHVSVI 351 LTD + + K NHV +I Sbjct: 285 LTDEPIAIIKSGDYNHVPMI 304 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,839 Number of Sequences: 336 Number of extensions: 2146 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -