BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L11 (392 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 25 0.24 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 25 0.24 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 1.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 1.7 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 1.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 1.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 1.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 2.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 2.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 2.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 2.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 2.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 2.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 2.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 22 2.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 2.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 2.2 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 2.2 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 2.2 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 2.2 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 2.2 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 2.2 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 2.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 2.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 2.2 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 2.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 2.2 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 2.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 2.2 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 2.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 2.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 2.9 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 3.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 20 8.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 20 8.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 20 8.8 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 25.4 bits (53), Expect = 0.24 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +3 Query: 135 GIQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTH-IRAKR 299 G+Q K D + + YEKR+ + V + K + R+G H +R KR Sbjct: 213 GLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVESGSESFK--RARMGFHGMRGKR 266 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 25.4 bits (53), Expect = 0.24 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +3 Query: 135 GIQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGTH-IRAKR 299 G+Q K D + + YEKR+ + V + K + R+G H +R KR Sbjct: 213 GLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVESGSESFK--RARMGFHGMRGKR 266 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 1.3 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 272 PRHTHPREEEA*RAQQRTNTDEEGGRTPSPPRHHSH 379 P HP + Q +T G T PP HH H Sbjct: 323 PSQYHPHRGSSPHHQHGNHTM---GPTMGPPHHHHH 355 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPLFEREEIKNVLTKI 186 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 1.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQ 332 LKRR G + +REE+ N+L + Sbjct: 159 LKRRTGEGSKPIFEREEIKNILNK 182 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKI 175 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKI 175 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKI 175 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 267 RRLGTHIRAKRKREELSNVLTQM 335 RR G + +REE+ NVLT++ Sbjct: 153 RRTGEGSKPLFEREEIKNVLTKI 175 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 267 RRLGTHIRAKRKREELSNVLTQM 335 RR G + +REE+ NVLT++ Sbjct: 164 RRTGEGSKPLFEREEIKNVLTKI 186 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 267 RRLGTHIRAKRKREELSNVLTQM 335 RR G + +REE+ NVLT++ Sbjct: 164 RRTGEGSKPLFEREEIKNVLTKI 186 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 2.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 267 RRLGTHIRAKRKREELSNVLTQM 335 RR G + +REE+ NVLT++ Sbjct: 153 RRTGEGSKPLFEREEIKNVLTKI 175 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 151 LIRRTGEGSKPIFEREEIKNVLTKI 175 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 167 LIRRTGEGSKPIFEREEIKNVLTKI 191 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 2.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 261 LKRRLGTHIRAKRKREELSNVLTQM 335 L RR G + +REE+ NVLT++ Sbjct: 162 LIRRTGEGSKPIFEREEIKNVLTKI 186 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 2.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 267 RRLGTHIRAKRKREELSNVLTQM 335 RR G + +REE+ NVLT++ Sbjct: 164 RRTGEGSKPIFEREEIKNVLTKI 186 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 3.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 147 KHSKFVRDLVREVVGHAQYEKRAME 221 K FV V EV+ + + EKR E Sbjct: 517 KKGSFVTQYVGEVITNEEAEKRGKE 541 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 8.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 375 EWWRGGLGVRPP 340 EW R LG+ PP Sbjct: 622 EWERCNLGLEPP 633 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 8.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 375 EWWRGGLGVRPP 340 EW R LG+ PP Sbjct: 622 EWERCNLGLEPP 633 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 8.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 375 EWWRGGLGVRPP 340 EW R LG+ PP Sbjct: 622 EWERCNLGLEPP 633 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,431 Number of Sequences: 438 Number of extensions: 2198 Number of successful extensions: 41 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9638226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -