BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L07 (538 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 25 0.32 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 25 0.32 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 3.0 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 3.0 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 3.9 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 21 6.9 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 21 9.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 9.1 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 25.4 bits (53), Expect = 0.32 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 132 RSCLREYQSSSPLCSDARLSC 194 R L +++ P+C D +LSC Sbjct: 96 RKVLPNFKTDEPICPDGKLSC 116 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 25.4 bits (53), Expect = 0.32 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 132 RSCLREYQSSSPLCSDARLSC 194 R L +++ P+C D +LSC Sbjct: 103 RKVLPNFKTDEPICPDGKLSC 123 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 3.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 346 LSELLHIFLVKFRVIFSGRVLVLLVFRNQIIDIALRLVEFHLVHA 212 LS +++ L+ F I + VLVL+V R + + + HL A Sbjct: 54 LSIIVYSILMVFSAIANTTVLVLIVKRRRKTPSRINTMLMHLAIA 98 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.2 bits (45), Expect = 3.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 346 LSELLHIFLVKFRVIFSGRVLVLLVFRNQIIDIALRLVEFHLVHA 212 LS +++ L+ F I + VLVL+V R + + + HL A Sbjct: 54 LSIIVYSILMVFSAIANTTVLVLIVKRRRKTPSRINTMLMHLAIA 98 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.8 bits (44), Expect = 3.9 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -1 Query: 115 TDECRGHLEAFRRDVTHGGLYVIRDPF 35 T R L AF+R + G Y PF Sbjct: 180 TAASRSRLAAFKRTIALGAFYQPLQPF 206 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.0 bits (42), Expect = 6.9 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +3 Query: 258 IWFRNTSSTRTRPLKMTRNLTRK 326 IWF+N + + +K +T+K Sbjct: 202 IWFQNRRAKERKQVKKREEVTQK 224 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +3 Query: 105 HSSVTPQPSRSCLREYQSSSPLCSDARL 188 HS P R C + + SS L R+ Sbjct: 72 HSGERPYRCRLCKKAFSDSSTLTKHLRI 99 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.6 bits (41), Expect = 9.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 182 KAFLHWYTGE 211 KA L W+TGE Sbjct: 333 KAHLRWHTGE 342 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +3 Query: 105 HSSVTPQPSRSCLREYQSSSPLCSDARL 188 HS P R C + + SS L R+ Sbjct: 328 HSGERPYRCRLCKKAFSDSSTLTKHLRI 355 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,492 Number of Sequences: 336 Number of extensions: 2618 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13097125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -