BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L05 (588 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 2.5 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 21 7.7 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.6 bits (46), Expect = 2.5 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -3 Query: 451 PPGNTGTGKHCQPPSTSARAPYAIRVPPSNMGFT*GCSLNLWNSL 317 PP +T +G Q P+T P SN+ G + N W SL Sbjct: 64 PPSSTSSGSLGQFPATPVIDPAKDPAIYSNLLPRPGSNDNSWESL 108 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = -1 Query: 480 GNRLCRRPASRRGTPAPASIANRLPLAPELRTRFGCRLQTW 358 G L + ++G P A+ LA ++ C L+ W Sbjct: 20 GRTLVEKGLRKQGVPREATKITLSSLAKGSLKQYTCELKLW 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,199 Number of Sequences: 336 Number of extensions: 3871 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -