BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L05 (588 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 29 0.045 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 2.9 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 6.8 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 9.0 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 28.7 bits (61), Expect = 0.045 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = +3 Query: 195 DKNTYGGSFIYHLNVAEGEAPLVATGFVVGLDYSNPYLSPFREFQR---FKLHPY 350 DKN G LN+ G+ GF G +Y N ++ E QR +L PY Sbjct: 66 DKNGMTGDAYGGLNIRPGQPSRQHAGFEFGKEYKNGFIKGQSEVQRGPGGRLSPY 120 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 480 GNRLCRRPASRRGTPAPAS 424 G++ CR AS G APAS Sbjct: 144 GDKSCRYTASLAGNVAPAS 162 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 207 YGGSFIYHLNVAE 245 YG +YHL+ AE Sbjct: 487 YGAGIVYHLSKAE 499 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 Query: 178 VCSTNPGLWFSGFTSHSSFKP 116 V S P WF TSH + P Sbjct: 22 VTSHRPAWWFWTATSHEASAP 42 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,239 Number of Sequences: 438 Number of extensions: 4618 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -