BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L04 (388 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 1.2 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 21 4.9 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 4.9 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 4.9 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 1.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 57 SSPYWPWLPQTEFTWWTIVVFHRTAIV 137 S+P W + P FTW I V A+V Sbjct: 549 SAPVWRFQPWGPFTWGGIGVVVLFAVV 575 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.0 bits (42), Expect = 4.9 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +2 Query: 128 GNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPLARGG 295 GN+ + I P P + EP + P ++ P +P R + P A G Sbjct: 71 GNNRPIYIPQPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRRE-PEAEPG 125 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.0 bits (42), Expect = 4.9 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 Query: 7 RQTTLTLFDNESFRVFLLRRIGHGCRKQSSR 99 RQ L +ESFR R CRK+ + Sbjct: 427 RQFLYCLAGDESFRKRRQREAAGNCRKRGEK 457 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 4.9 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = +2 Query: 161 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 271 DP+F + ++ ++ +D NHP + K Y Sbjct: 171 DPWFPRHASDLDNCNHLMTKFEPDLDMNHPGFADKEY 207 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,475 Number of Sequences: 438 Number of extensions: 2475 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9391092 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -