BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_L02 (569 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54471| Best HMM Match : PHD (HMM E-Value=4.9e-08) 30 1.2 SB_48410| Best HMM Match : Lig_chan (HMM E-Value=3.5e-05) 30 1.5 SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 29 3.5 SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) 28 4.7 SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 28 6.2 SB_48408| Best HMM Match : Lig_chan (HMM E-Value=0.19) 27 8.2 SB_36053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_767| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_54471| Best HMM Match : PHD (HMM E-Value=4.9e-08) Length = 352 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 123 ESCQIKWLDCRVQPVYRHLGMLQWSSPLCEHLL 25 +SC+I+WL + + G +W P CE LL Sbjct: 316 QSCEIEWLHIECDGLRQVPGEDEWICPFCEELL 348 >SB_48410| Best HMM Match : Lig_chan (HMM E-Value=3.5e-05) Length = 1084 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -1 Query: 542 IHNNEYF*NLNMYDSFQNTLQNINILSA 459 I ++EYF N+ SF NT NINI+SA Sbjct: 24 ILSDEYFPAQNISSSFPNTQVNINIISA 51 >SB_46123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Frame = +3 Query: 9 SSTDSTANAHRVVKTIVTSPDVYKPVGPYSQAILSD---KTLYISGVLGMDRDAQLVSGG 179 S + ++ V + S + P PYS A++SD + + V ++ + LV GG Sbjct: 395 SKSQDSSPPQSVFSSPKPSSVISTPTTPYSPAVMSDGVPSSRWGHAVCAINENEALVVGG 454 Query: 180 VGAQTRQVLENLKHVVEAGGGSLE 251 G + + V ++L + + G E Sbjct: 455 QGPKFQMVKDSLWLLSSSAAGEFE 478 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -3 Query: 252 TPKIHLPPQLHASSFLKLGASVLPLHQIPTAHHDPCRVLPIY 127 +P++H P+ ++ VLP + P HH P +P Y Sbjct: 516 SPRVHQSPRTPVPAYFT--PRVLPAYTTPRVHHSPRTPVPAY 555 >SB_44560| Best HMM Match : DUF1086 (HMM E-Value=1.2) Length = 918 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +3 Query: 123 LYISGVLGMDRDAQLVSGGVGAQTRQVLENLKHVVEAGGGSLESVIKTTIL 275 LY +GV G + + QTRQ+L + ++++ S++ V T+L Sbjct: 548 LYFTGVWGRYSNGSVKETSCDNQTRQILGRIDNLIKCATESIQPVEVETVL 598 >SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 1145 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 442 PASVMTRSPLRAIASISTAAFRGSLV 365 P +++ SP+ + SI+ AA RGSL+ Sbjct: 734 PCALVMTSPIAVVCSITAAARRGSLI 759 >SB_48408| Best HMM Match : Lig_chan (HMM E-Value=0.19) Length = 705 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -1 Query: 542 IHNNEYF*NLNMYDSFQNTLQNINILSA 459 I + EYF N+ F NT NINI+SA Sbjct: 24 ILSEEYFPAQNILSIFPNTKVNINIISA 51 >SB_36053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 286 WTIFNALIKFMLNIFLKIALHGL 354 WT+ NA+ +L L +ALHGL Sbjct: 8 WTVLNAVAGLVLPSVLVVALHGL 30 >SB_767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 235 PASTTCFKFSKTWRVCAPTPPDTNCASR-SMPSTP 134 PA C K+ K +C P P N S+ S P TP Sbjct: 128 PAMFDCSKYLKDDMMCVPLPETPNPTSKTSSPPTP 162 >SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 27.5 bits (58), Expect = 8.2 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +1 Query: 130 YREYSAWIVMRSWYL 174 Y E+S+W+V R+W+L Sbjct: 342 YGEFSSWLVWRTWFL 356 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,214,638 Number of Sequences: 59808 Number of extensions: 389260 Number of successful extensions: 812 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -