BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K24 (529 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61350.1 68418.m07698 protein kinase family protein contains ... 29 1.9 At2g39360.1 68415.m04831 protein kinase family protein contains ... 29 1.9 At4g15093.1 68417.m02319 catalytic LigB subunit of aromatic ring... 28 4.5 >At5g61350.1 68418.m07698 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 842 Score = 29.1 bits (62), Expect = 1.9 Identities = 23/69 (33%), Positives = 31/69 (44%) Frame = +2 Query: 227 RLVVNKLLAESKRNVVDYAYKLVRKGEIGIVRDYFPIHFRWILLGEQVKFINLRDANALK 406 R V+N L + N+ +YA L RKG + + D P I G KF+ A Sbjct: 728 RPVINPQLPREQVNLAEYAMNLHRKGMLEKIID--PKIVGTISKGSLRKFVEA--AEKCL 783 Query: 407 LEWGTDRDG 433 E+G DR G Sbjct: 784 AEYGVDRPG 792 >At2g39360.1 68415.m04831 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 815 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 227 RLVVNKLLAESKRNVVDYAYKLVRKGEIGIVRDYF 331 R V++ L K N++++A KLV+KG++ + D F Sbjct: 686 RPVIDPSLPREKVNLIEWAMKLVKKGKLEDIIDPF 720 >At4g15093.1 68417.m02319 catalytic LigB subunit of aromatic ring-opening dioxygenase family contains Pfam PF02900: Catalytic LigB subunit of aromatic ring-opening dioxygenase Length = 269 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 437 RGAYGDKNEWESDRMSWKIIPHWWNQRAY 523 +G YGD NEWE + K + H W + Y Sbjct: 204 QGRYGDVNEWEEKAPNAK-MAHPWPEHLY 231 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,601,865 Number of Sequences: 28952 Number of extensions: 200388 Number of successful extensions: 540 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -