BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K22 (421 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB209701-1|BAD92938.1| 484|Homo sapiens sparc/osteonectin, cwcv... 29 4.8 X73608-1|CAA51999.1| 439|Homo sapiens testican protein. 29 8.4 BC030691-1|AAH30691.1| 439|Homo sapiens sparc/osteonectin, cwcv... 29 8.4 AF231124-1|AAF43687.1| 439|Homo sapiens testican-1 protein. 29 8.4 >AB209701-1|BAD92938.1| 484|Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan precursor variant protein. Length = 484 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 269 HWRYLNRDRWTKNILEQRFRRNWNRFQDHRE 361 H +L+ D+W + + + WNRF+D E Sbjct: 77 HGNFLDNDQWLSTVSQYDRDKYWNRFRDEVE 107 >X73608-1|CAA51999.1| 439|Homo sapiens testican protein. Length = 439 Score = 28.7 bits (61), Expect = 8.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 269 HWRYLNRDRWTKNILEQRFRRNWNRFQD 352 H +L+ D+W + + + WNRF+D Sbjct: 35 HGNFLDNDQWLSTVSQYDRDKYWNRFRD 62 >BC030691-1|AAH30691.1| 439|Homo sapiens sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1 protein. Length = 439 Score = 28.7 bits (61), Expect = 8.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 269 HWRYLNRDRWTKNILEQRFRRNWNRFQD 352 H +L+ D+W + + + WNRF+D Sbjct: 35 HGNFLDNDQWLSTVSQYDRDKYWNRFRD 62 >AF231124-1|AAF43687.1| 439|Homo sapiens testican-1 protein. Length = 439 Score = 28.7 bits (61), Expect = 8.4 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 269 HWRYLNRDRWTKNILEQRFRRNWNRFQD 352 H +L+ D+W + + + WNRF+D Sbjct: 35 HGNFLDNDQWLSTVSQYDRDKYWNRFRD 62 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,539,287 Number of Sequences: 237096 Number of extensions: 1291414 Number of successful extensions: 2507 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2507 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3202085264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -