BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K17 (179 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 0.34 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 19 4.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 19 4.1 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 19 5.5 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 19 5.5 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 19 7.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 18 9.6 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 18 9.6 AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 18 9.6 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 18 9.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 18 9.6 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.0 bits (47), Expect = 0.34 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 16 SSPYWPWLPQTEFTWWTIVVFHRTAIV 96 S+P W + P FTW I V A+V Sbjct: 549 SAPVWRFQPWGPFTWGGIGVVVLFAVV 575 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 19.4 bits (38), Expect = 4.1 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = -3 Query: 123 DPGSQ*QRGHYCRPMEHHY 67 D G RGH + HH+ Sbjct: 388 DSGENNSRGHSGQSSSHHH 406 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 19.4 bits (38), Expect = 4.1 Identities = 5/18 (27%), Positives = 9/18 (50%) Frame = +1 Query: 16 SSPYWPWLPQTEFTWWTI 69 S P + W + E W+ + Sbjct: 258 SHPTYDWFEKLELKWFAV 275 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 19.0 bits (37), Expect = 5.5 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +3 Query: 51 VHVVDNSGVPSDGNSDHVVIANPDPFFSQPSN 146 V ++ N GVPS N I N P N Sbjct: 79 VTILRNDGVPSSLNVISNKIGNGGPLLEPYPN 110 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 19.0 bits (37), Expect = 5.5 Identities = 5/12 (41%), Positives = 6/12 (50%) Frame = +1 Query: 10 FSSSPYWPWLPQ 45 + PYW W Q Sbjct: 834 YGERPYWNWSNQ 845 Score = 18.2 bits (35), Expect = 9.6 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +2 Query: 104 CYCEPGSF 127 C C+PG F Sbjct: 296 CRCDPGYF 303 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 18.6 bits (36), Expect = 7.2 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 Query: 93 YCRPMEHHYCPPRELCLRQPW 31 YC P P REL + Q W Sbjct: 271 YCEPQVVIVSPTRELTI-QIW 290 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 18.2 bits (35), Expect = 9.6 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 147 RLMVERRKDPGSQ*QRGH 94 R ++ER + P Q GH Sbjct: 1914 RKLIERNEAPSRQTGSGH 1931 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 18.2 bits (35), Expect = 9.6 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 Query: 41 GSHGQYGEE 15 GS+G+YG E Sbjct: 148 GSYGEYGIE 156 >AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. Length = 122 Score = 18.2 bits (35), Expect = 9.6 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -3 Query: 150 DRLMVERRKDPGSQ*QRGHYCRPMEHHYCPPR 55 D L + DP +Q G+Y ++ Y R Sbjct: 79 DTLKSKMEIDPATQKDAGYYECQADNQYAVDR 110 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 18.2 bits (35), Expect = 9.6 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +2 Query: 35 GCRKQSSRG 61 GC +Q+SRG Sbjct: 13 GCDEQTSRG 21 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 18.2 bits (35), Expect = 9.6 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 Query: 41 GSHGQYGEE 15 GS+G+YG E Sbjct: 238 GSYGEYGIE 246 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,135 Number of Sequences: 438 Number of extensions: 978 Number of successful extensions: 12 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 39 effective length of database: 129,261 effective search space used: 2585220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.9 bits)
- SilkBase 1999-2023 -