BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K16 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) 40 0.001 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 39 0.002 SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 37 0.013 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 37 0.013 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_15403| Best HMM Match : CH (HMM E-Value=0) 36 0.022 SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) 35 0.038 SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) 35 0.051 SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) 34 0.067 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 34 0.089 SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) 33 0.12 SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) 33 0.16 SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) 32 0.27 SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) 32 0.36 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 31 0.47 SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) 31 0.63 SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) 31 0.83 SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) 30 1.1 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 30 1.1 SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 28 4.4 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 5.8 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 27 7.7 SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) 27 7.7 SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_41491| Best HMM Match : Kazal_1 (HMM E-Value=1.1e-12) Length = 77 Score = 39.9 bits (89), Expect = 0.001 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +2 Query: 401 KCAEN-CISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLARQAPCP 544 KC ++ + T +Y+PVCGSD KTY N L A C + + + CP Sbjct: 24 KCDDSPTLCTLQYDPVCGSDGKTYGNMCFLKAAIKCNPDLYMKHKGACP 72 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/47 (48%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRL-FCAQNCGVQVTLARQAPC 541 C +NC ST + PVCGSD KTYKN+ L A VT+A Q C Sbjct: 3970 CNKNCPSTSK--PVCGSDGKTYKNECELKRAACESKKNVTVASQGEC 4014 Score = 31.9 bits (69), Expect = 0.36 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKN 475 +C C+ P+ PVCG+D KTY+N Sbjct: 4236 ECPSRCL--PDKEPVCGADGKTYRN 4258 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 39.1 bits (87), Expect = 0.002 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNC--GVQVTLARQAPCP 544 +C + C T EY P CG+D TY N+ + Q+C G ++ LA PCP Sbjct: 278 ECPKAC--TREYKPACGTDGNTYPNR-CVLAIQSCETGEKLQLAHDGPCP 324 Score = 36.3 bits (80), Expect = 0.017 Identities = 20/49 (40%), Positives = 25/49 (51%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLARQAPCPS 547 +C C T E PVCG+D KTY N L A + LA + PCP+ Sbjct: 117 ECPRAC--TRELMPVCGTDQKTYDNMCLLERAACKDDGLMLAHEGPCPT 163 Score = 35.5 bits (78), Expect = 0.029 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNC--GVQVTLARQAPCPSS 550 Q + C E C T EY PVCGSD KTY N L ++C ++++ ++ C S Sbjct: 37 QPVCVCNEAC--TREYAPVCGSDGKTYPNPCALE-VESCKTNTRISVIKKGSCDDS 89 Score = 35.5 bits (78), Expect = 0.029 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPCP 544 +C + C T +Y PVCGSD KTY N L C ++ L PCP Sbjct: 195 ECPKVC--TLDYTPVCGSDNKTYANLCNLEVEACKPENTDKLQLLHDGPCP 243 >SB_46203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 37.5 bits (83), Expect = 0.007 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +2 Query: 416 CISTPEYN-PVCGSDYKTYKNQGRL-FCAQNCGVQVTLARQAPC 541 C+S P+ N PVCGS+ K Y N+ L A +T+AR++PC Sbjct: 205 CMSCPKMNKPVCGSNGKDYNNECELQQFACKTNTMITVARRSPC 248 Score = 31.1 bits (67), Expect = 0.63 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +2 Query: 416 CISTPEY-NPVCGSDYKTYKNQGRL-FCAQNCGVQVTLARQAPCPSS 550 C+S P +PVCGSD K Y N+ L A +T+ R+ C S+ Sbjct: 111 CLSCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDACLST 157 Score = 30.7 bits (66), Expect = 0.83 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 416 CISTPEY-NPVCGSDYKTYKNQGRL-FCAQNCGVQVTLARQAPCP 544 C+S P +PVCGSD K Y N +L A +TL + CP Sbjct: 274 CLSCPNMLDPVCGSDGKNYDNVCKLRQNACKTNTLITLISRDACP 318 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 36.7 bits (81), Expect = 0.013 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQ---GRLFCAQNCGVQVTLARQAPC 541 C+ I T EY+P+CGSD KTY NQ R C QN + + PC Sbjct: 5152 CSCPDICTFEYSPLCGSDGKTYDNQCEMERASCLQNKDLTGKPGKCDPC 5200 Score = 33.1 bits (72), Expect = 0.16 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPC 541 C N I T EY PVCG+D ++Y N+ L C +N ++V A Q C Sbjct: 5222 CTCNSICTLEYAPVCGTDGQSYDNECLLQTASCQRNELIEV--ATQGTC 5268 Score = 33.1 bits (72), Expect = 0.16 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 416 CISTPEY-NPVCGSDYKTYKNQGRL-FCAQNCGVQVTLARQAPCP 544 C+S P +PVCGSD K Y N+ L A +T+ R+ CP Sbjct: 5790 CLSCPNILDPVCGSDGKNYDNECNLRQNACKTNTLITVVRRDACP 5834 Score = 31.9 bits (69), Expect = 0.36 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 416 CISTPEYN-PVCGSDYKTYKNQGRL 487 C S P N PVCGSD KTY N+ L Sbjct: 5621 CQSCPSINKPVCGSDGKTYNNECEL 5645 Score = 31.5 bits (68), Expect = 0.47 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 3/40 (7%) Frame = +2 Query: 431 EYNPVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPC 541 +Y PVCG+D +TY+N+ L C +N QV +A Q C Sbjct: 5558 DYTPVCGTDGETYENECTLQISSCQRN--EQVEVASQGHC 5595 Score = 28.7 bits (61), Expect = 3.3 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPCPSS 550 +C + I + Y PVCG+D + Y N+ L C +N ++V A + CP++ Sbjct: 5292 ECVCDGICSLVYAPVCGTDGQEYSNECNLQIASCRKNELIEV--ASRGSCPTT 5342 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 36.7 bits (81), Expect = 0.013 Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLA--RQAPC 541 C ENC ST + PVCGSD TY N+ L Q C T+A R+ C Sbjct: 275 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVAVRRKGDC 319 Score = 35.9 bits (79), Expect = 0.022 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLARQ-----APCPSS 550 C ENC ST + PVCG+D TY N+ L Q C T+A + PCP + Sbjct: 161 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVAVRRKGHCEPCPKT 211 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 36.7 bits (81), Expect = 0.013 Identities = 22/48 (45%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLA--RQAPC 541 C ENC ST + PVCGSD TY N+ L Q C T+A R+ C Sbjct: 1206 CPENCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVAVRRKGDC 1250 Score = 35.1 bits (77), Expect = 0.038 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLA 526 C ENC ST + PVCG+D TY N+ L Q C T+A Sbjct: 1135 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVA 1172 Score = 35.1 bits (77), Expect = 0.038 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQ---GRLFCAQNCGVQVTLARQAPC 541 C ++C T E P+C SD +TY N+ + C N + VT R PC Sbjct: 2154 CPDDC--TNETKPICASDGQTYDNECLMQKRACENNQNLNVTSDRACPC 2200 Score = 33.9 bits (74), Expect = 0.089 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPCP 544 C +C P+CGS+ KTY N+ L C N + + ++ P P Sbjct: 289 CPSSCGDESLPQPICGSNNKTYANECELRMDSCKNNKSIAIQFRKECPAP 338 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTL 523 +C+E+C T PVCGSD Y N+ L A+ C T+ Sbjct: 1372 ECSEDCPKT--LKPVCGSDNNDYDNE-CLMQARACATNKTI 1409 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 437 NPVCGSDYKTYKNQGRL 487 +PVCGSD KTY N+ R+ Sbjct: 617 DPVCGSDSKTYPNECRM 633 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +2 Query: 416 CISTPEYN-PVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPCP 544 C P+ + PVCG++ KTY ++ L C N + V L + PCP Sbjct: 679 CPECPQVDKPVCGTNNKTYTSECALQVDACKTNTSIDVQLDK--PCP 723 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 428 PEYNPVCGSDYKTYKNQ-GRLFCAQNCGVQVTLARQAPC 541 P PVCGSD TY+++ G + A +TL C Sbjct: 2631 PTLTPVCGSDGVTYESECGMIQKACQTNTSITLVANEAC 2669 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDYKTYKNQ---GRLFCAQNCGVQV-TLARQAPC 541 + + +C ++C E VCG+++KTY N+ + C N V V ++ R PC Sbjct: 1785 EAVCECPKDC--PKEDAEVCGTNWKTYTNECMMRKQACMNNSMVTVRSIGRCDPC 1837 >SB_15403| Best HMM Match : CH (HMM E-Value=0) Length = 1907 Score = 35.9 bits (79), Expect = 0.022 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLAR--QAPC 541 +C + P Y+P+CG+D KTY N L A C Q ++ R + PC Sbjct: 1232 RCECDLRPDPAYDPICGTDGKTYNNDKDLESAA-CAQQTSIVRWHKGPC 1279 Score = 34.7 bits (76), Expect = 0.051 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLAR 529 KC + T EY PVCGSD TY N L A C Q + R Sbjct: 721 KCVCSAACTREYAPVCGSDGNTYNNL-CLLTAARCQSQTFIYR 762 >SB_33509| Best HMM Match : Kazal_1 (HMM E-Value=2.3e-26) Length = 143 Score = 35.1 bits (77), Expect = 0.038 Identities = 19/41 (46%), Positives = 23/41 (56%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLA 526 C ENC ST + PVCG+D TY N+ L Q C T+A Sbjct: 27 CPENCSSTVD--PVCGTDNNTYDNE-CLMRQQACVANATVA 64 >SB_135| Best HMM Match : Kazal_1 (HMM E-Value=2.9e-19) Length = 92 Score = 34.7 bits (76), Expect = 0.051 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQ--VTLARQAPCPSS 550 I +C N T Y PVCG+D KTY N+ L A C + V LA + C S+ Sbjct: 34 IVRCVCNRACTKIYRPVCGTDGKTYGNKCVLEIA-TCESEGAVQLAHEGECDSA 86 >SB_39834| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 293 Score = 34.3 bits (75), Expect = 0.067 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKN 475 +C C T E NPVCGSD KTY N Sbjct: 117 RCMRRC--TKELNPVCGSDGKTYDN 139 Score = 33.1 bits (72), Expect = 0.16 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQ-NCGVQVTLARQAPCPSS 550 +KCA C Y PVCGSD TY N L A +T+ + C SS Sbjct: 167 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSS 216 Score = 31.1 bits (67), Expect = 0.63 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDYKTYKNQ---GRLFCAQNCGVQVTLARQAPC 541 ++ C C + Y PVCG+D KTY N+ G C N G +TLA C Sbjct: 41 VDPCVRPCPAI--YMPVCGTDGKTYGNKCMLGAATCRSN-GT-ITLAYPGEC 88 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 33.9 bits (74), Expect = 0.089 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +2 Query: 386 RQTIEKCAENCISTPEYNPVCGSDYKTYKNQGRLFC-AQNCGVQVTLARQAPC 541 RQ + C ++ PVCGSD +TY N RL G VT+ RQ C Sbjct: 430 RQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRLQVEVCQTGRAVTVLRQGAC 482 Score = 31.9 bits (69), Expect = 0.36 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +2 Query: 425 TPEYNPVCGSDYKTYKNQ---GRLFCAQNCGVQVTLARQAPCP 544 T +Y PVCG D K+Y + RL C + GV + +A + CP Sbjct: 1758 TLKYTPVCGDDGKSYLSTCMLKRLACLK--GVHIAIASKGRCP 1798 Score = 31.1 bits (67), Expect = 0.63 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +2 Query: 431 EYNPVCGSDYKTYKNQGRL---FCAQNCGVQV 517 E +PVCGSD KTY+N+ +L C N V++ Sbjct: 516 EASPVCGSDGKTYENECKLRVESCKANQNVRI 547 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +2 Query: 434 YNPVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPCPSS 550 Y+PVCGS+ KTY N L C +N +++ + C S+ Sbjct: 1830 YDPVCGSNRKTYLNFCSLTAEACKKNLPIKMAYKGRCCCAST 1871 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTYKN 475 C NC S +++PVCG D TY+N Sbjct: 579 CPTNCPS--DWDPVCGDDGVTYQN 600 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFC-AQNCGVQVTLARQAPC 541 KC+ P PVCGSD K+Y ++ L A +++TL + C Sbjct: 1679 KCSCPIYCPPSGQPVCGSDGKSYGSECELRKEACEAKIKLTLVSKGKC 1726 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +2 Query: 413 NCISTPEYNPVCGSDYKTYKNQGRL---FCAQNCGVQVTLARQAPC 541 +C P+ PVCG+D K Y N+ L CA N + + + + PC Sbjct: 816 SCDKMPD--PVCGTDNKEYANECLLNVAACAAN--IHLRVLNKGPC 857 >SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1568 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 440 PVCGSDYKTYKNQGRLFCAQ-NCGVQVTLARQAPCPSS 550 PVCGSD KTY N+ + A +T++ PCP + Sbjct: 1078 PVCGSDGKTYNNECLMRAASCKANKNITVSSYFPCPET 1115 >SB_6081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 33.5 bits (73), Expect = 0.12 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 425 TPEYNPVCGSDYKTYKNQGRL 487 T +YNPVCGSD +TY N+ + Sbjct: 15 TADYNPVCGSDGRTYPNRASM 35 >SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2101 Score = 33.5 bits (73), Expect = 0.12 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNC--GVQVTLARQAPCPSS 550 KC C T EY PVCG+D KTY N+ + A C VT+A C S+ Sbjct: 1294 KCPIFC--TYEYMPVCGTDGKTYGNKCEM-RASACLKSTMVTVAYPGECESN 1342 Score = 31.5 bits (68), Expect = 0.47 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQ----VTLARQAPCPSS 550 KC + + T +Y PVC SD KTY N+ +N G + + + Q CP + Sbjct: 1522 KCRQ--MMTADYTPVCASDGKTYPNR---MSMENAGCEKNMILRIVSQGECPKA 1570 Score = 31.5 bits (68), Expect = 0.47 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLARQA 535 +C ++T EY PVC SD K Y N+ +N G + + +A Sbjct: 1966 ECVCRTVTTLEYRPVCASDGKIYPNR---MTMENAGCEKNMVLRA 2007 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRL 487 KC + I +P +PVCGSD K YK+ L Sbjct: 1753 KCPPS-ICSPVISPVCGSDGKIYKDDCEL 1780 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 443 VCGSDYKTYKNQGRLF-CAQNCGVQVTLARQAPCP 544 VCGSD TY N+ L A +T+ Q PCP Sbjct: 1452 VCGSDRMTYSNECTLTQTACQESKNLTVVSQGPCP 1486 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 425 TPEYNPVCGSDYKTYKN 475 T +Y+PVC SD +TY N Sbjct: 1818 TADYSPVCASDGQTYPN 1834 >SB_39831| Best HMM Match : Kazal_1 (HMM E-Value=2.4e-19) Length = 173 Score = 33.1 bits (72), Expect = 0.16 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQ-NCGVQVTLARQAPCPSS 550 +KCA C Y PVCGSD TY N L A +T+ + C SS Sbjct: 24 DKCAPIC--NKMYQPVCGSDNVTYSNPCMLRSATCKSNGTITMKHRGKCGSS 73 >SB_58159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 32.3 bits (70), Expect = 0.27 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLARQAPC 541 +C E C S E +PVCG+D +TY ++ L A+ G +V + + C Sbjct: 205 RCHEPCPS--EASPVCGTDMRTYASRCHLQLAKCKGHKVKMIYKGRC 249 >SB_32965| Best HMM Match : Kazal_1 (HMM E-Value=3.4e-19) Length = 69 Score = 32.3 bits (70), Expect = 0.27 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 395 IEKCAENCISTPEYN-PVCGSDYKTYKNQGRLFCAQ-NCGVQVTLARQAPC 541 ++KC C P N PVCG+D KTY N+ L A + +TLA C Sbjct: 21 VDKCVRPC---PAINDPVCGTDGKTYGNECMLGAATCHSNGTITLAYPGEC 68 >SB_33512| Best HMM Match : Kazal_1 (HMM E-Value=2.6e-20) Length = 87 Score = 31.9 bits (69), Expect = 0.36 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +2 Query: 413 NCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLARQ-----APCPSS 550 NC ST + PVCGSD TY N+ L Q C T+A + PCP + Sbjct: 2 NCSSTVD--PVCGSDNNTYDNE-CLMRQQACVANTTVAVRRKGDCEPCPKT 49 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 31.5 bits (68), Expect = 0.47 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +2 Query: 389 QTIEKCAENCISTPEYNPVCGSDYKTYKNQ 478 Q + +C C T EY PVCGSD KTY + Sbjct: 42 QPVCECPMAC--TREYAPVCGSDGKTYPTE 69 >SB_11826| Best HMM Match : Kazal_1 (HMM E-Value=1.2e-16) Length = 98 Score = 31.1 bits (67), Expect = 0.63 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQ--VTLARQAPC 541 I +C N Y+P+CG+D KTY N+ L A C + V LA + C Sbjct: 34 IARCVCNRACKKIYSPMCGTDGKTYGNKCMLEIA-TCESEGAVKLAHEGEC 83 >SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 1488 Score = 30.7 bits (66), Expect = 0.83 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +2 Query: 404 CAENCISTPEYNPVCGSDYKTY-KNQGRLFCAQNCGVQVTLARQAPC 541 C +C T Y+PVCG D TY N R+ A N + PC Sbjct: 252 CPSDCSHT--YSPVCGGDKTTYINNCTRIAAACNMKKDIPFNVNGPC 296 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 401 KCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCGVQVTLARQAP 538 +C C S E +PVCG D +TY + + A+ C Q ++A + P Sbjct: 802 ECNTECPS--EASPVCGQDGRTYSSTCAM-DARACQAQTSIAVKHP 844 >SB_44384| Best HMM Match : Kazal_1 (HMM E-Value=1.4e-21) Length = 85 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 398 EKCAENCISTPEYNPVCGSDYKTYKN 475 +KCA C Y PVCGSD TY N Sbjct: 38 DKCAPICPKI--YRPVCGSDNVTYSN 61 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +2 Query: 440 PVCGSDYKTYKNQGRLFCAQNCGV------QVTLARQAPC 541 PVCGSD KTY N L A+ C + Q+TL + PC Sbjct: 246 PVCGSDGKTYTNGCELATAK-CALPKGQKRQLTLKHRGPC 284 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 92 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 226 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_36847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = +2 Query: 401 KCAENCIST-PEY-NPVCGSDYKTYKNQ---GRLFCAQNCGVQVTLARQAPC 541 K + C+S P++ PVCGSD TY N R+ C ++T+ + PC Sbjct: 76 KASCECLSECPDHIKPVCGSDGVTYPNHCELHRIACVHT--KKITIRSKGPC 125 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 28.3 bits (60), Expect = 4.4 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +2 Query: 104 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 283 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 284 NFIAFIFP 307 + IFP Sbjct: 669 GDMNTIFP 676 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 4.4 Identities = 9/37 (24%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +3 Query: 15 LYLYLCYKICHINYFYY----YNLKWISCARFLYWVL 113 ++L+ +CH+NY Y+ +++ W+ ++Y V+ Sbjct: 121 IWLFHVSLLCHVNYMYHVIWLFHVSWLCHVNYMYHVI 157 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 107 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 238 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 27.5 bits (58), Expect = 7.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 404 CAENCISTPEYNPVC 448 C +CISTP Y+ +C Sbjct: 1196 CVHSCISTPRYDQIC 1210 >SB_29074| Best HMM Match : Kazal_2 (HMM E-Value=3.3e-16) Length = 711 Score = 27.5 bits (58), Expect = 7.7 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 395 IEKCAENCISTPEYNPVCGSDYKTYKNQGRLFCAQNCG-VQVTLARQAPC 541 ++ C E C P PVCG D+ TY++ L A+ CG + Q PC Sbjct: 300 VDTCME-CDKEP-VTPVCGPDWTTYRS---LCHARFCGNYDIDEIVQGPC 344 >SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 536 GLAWPKSLGLHNFGHKIVFPGFCKFYNRYHTR 441 G P LH G K+ + GFCK Y + T+ Sbjct: 197 GQQHPNLCSLHFQGKKLAYKGFCKSYCKSPTK 228 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,928,580 Number of Sequences: 59808 Number of extensions: 403219 Number of successful extensions: 1243 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1219 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -