BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K14 (594 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98866-24|CAB11568.2| 366|Caenorhabditis elegans Hypothetical p... 30 1.4 AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical ... 29 2.5 Z71259-6|CAA95792.1| 328|Caenorhabditis elegans Hypothetical pr... 28 5.8 Z46793-4|CAA86773.1| 889|Caenorhabditis elegans Hypothetical pr... 27 7.6 Z34800-5|CAA84325.1| 889|Caenorhabditis elegans Hypothetical pr... 27 7.6 >Z98866-24|CAB11568.2| 366|Caenorhabditis elegans Hypothetical protein Y49E10.25 protein. Length = 366 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 273 KLLLEGQPNVVEYAYSLWYRSGEDIVKVYFPIEFRLLFNEDPV 401 KL+ GQP V +Y ++ W+ FP FR++ + DP+ Sbjct: 260 KLVTFGQPRVADYDHAAWH-------DATFPYSFRVINSRDPI 295 >AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical protein K03H6.2 protein. Length = 348 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 273 KLLLEGQPNVVEYAYSLWYRS 335 KLL GQP +YAYS W+++ Sbjct: 227 KLLTAGQPRTGDYAYSNWHQN 247 >Z71259-6|CAA95792.1| 328|Caenorhabditis elegans Hypothetical protein F13G3.6 protein. Length = 328 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/70 (27%), Positives = 30/70 (42%) Frame = +3 Query: 378 LLFNEDPVLITNKRDELALKLELKTDYAGDRASFGAGQTKTGPRVSWKLYPIWYKNKVYF 557 L FN+ + + R + L+L K +GD F GQ P S Y W + + Sbjct: 97 LCFNDADDVSSPNRIKSQLELATKLSKSGDDLIFVGGQFHRLPEGSTTRYTKWANSMIGD 156 Query: 558 KILNTYHTQY 587 KI + +T + Sbjct: 157 KIRSQVYTSH 166 >Z46793-4|CAA86773.1| 889|Caenorhabditis elegans Hypothetical protein F45H7.6 protein. Length = 889 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 372 FRLLFNEDPVLITNKRDELALKLELKTDYAG 464 FR++ N DP ++ R + + EL DY G Sbjct: 534 FRIILNVDPFVLKKSRLHIRFEGELALDYGG 564 >Z34800-5|CAA84325.1| 889|Caenorhabditis elegans Hypothetical protein F45H7.6 protein. Length = 889 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 372 FRLLFNEDPVLITNKRDELALKLELKTDYAG 464 FR++ N DP ++ R + + EL DY G Sbjct: 534 FRIILNVDPFVLKKSRLHIRFEGELALDYGG 564 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,007,924 Number of Sequences: 27780 Number of extensions: 224375 Number of successful extensions: 522 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -