BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K07 (531 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 57 1e-10 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 1.9 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 3.4 U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. 21 7.9 AF442147-1|AAL35348.1| 33|Apis mellifera abaecin precursor pro... 21 7.9 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 56.8 bits (131), Expect = 1e-10 Identities = 50/156 (32%), Positives = 73/156 (46%), Gaps = 2/156 (1%) Frame = +1 Query: 13 HDIALIRLMVTAPYTDFVRPICLPSLDYTQQPPADFEMYVAGWGMYKQFISGTGLSSTVK 192 +DIAL++ + D V P CLP + A ++ V GWG S G+ S + Sbjct: 256 NDIALLKTEKDIKFGDKVGPACLPFQHFLDSF-AGSDVTVLGWG----HTSFNGMLSHIL 310 Query: 193 QHVKLPYVDRDRCQAAQRTLRGGEALVITKEQLCAGGKPGEDACRGDSGGPLMYEVGNT- 369 Q L + + C G +V +CA K G+DAC+ DSGGP++++ T Sbjct: 311 QKTTLNMLTQVECYKYY-----GNIMV---NAMCAYAK-GKDACQMDSGGPVLWQNPRTK 361 Query: 370 -FVMVGSVSYGPKYCGTRNIPGVYTNVYEYIPWIRS 474 V +G +S+G + CG P T V YI WI S Sbjct: 362 RLVNIGIISWGAE-CG--KYPNGNTKVGSYIDWIVS 394 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 362 PTSYMRGPPESPLHASSPGLPP 297 P + RG P +P PG PP Sbjct: 31 PQAPQRGSPPNPSQGPPPGGPP 52 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 341 PPESPLHASSPGLPPAHSCS-LVITSAS 261 P + P PG PP+ + S ++I+ AS Sbjct: 42 PSQGPPPGGPPGAPPSQNPSQMMISPAS 69 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 3.4 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +1 Query: 133 AGWGMYKQFISGTGLSSTVKQHVKLPYVDRDRCQAAQRTLRGGEA 267 AG+ + I G + +KLP R A +TL+ G A Sbjct: 630 AGYITIEAIIGGGEFGDVCRGKLKLPPDGRTEIDVAIKTLKPGSA 674 >U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. Length = 53 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 Query: 133 RRTFQNLPGVVAYNPK 86 RR F PG +NPK Sbjct: 31 RRPFPTFPGQGPFNPK 46 >AF442147-1|AAL35348.1| 33|Apis mellifera abaecin precursor protein. Length = 33 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 Query: 133 RRTFQNLPGVVAYNPK 86 RR F PG +NPK Sbjct: 17 RRPFPTFPGQGPFNPK 32 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,987 Number of Sequences: 438 Number of extensions: 4044 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -