BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K05 (452 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0481 + 8789890-8789949,8790325-8790441,8790532-8790601,879... 30 1.0 03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324,874... 29 1.3 08_01_0189 + 1578935-1578950,1579227-1579390,1579493-1579605,157... 27 7.1 08_01_0525 + 4564885-4565221,4565337-4565476,4565582-4565677,456... 27 9.3 02_03_0069 - 14728968-14729368,14729434-14729800,14730099-14730149 27 9.3 >03_02_0481 + 8789890-8789949,8790325-8790441,8790532-8790601, 8790688-8790836,8791520-8791621,8791692-8791892, 8792589-8792651,8792791-8793009,8793681-8793755, 8794003-8794101,8794521-8794691 Length = 441 Score = 29.9 bits (64), Expect = 1.0 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +2 Query: 293 LYDFEAAEDNELTFLAGETVHVTDSSDPNWWKGYNERGEGLFPANFVTDETSA 451 ++ F+A D EL+ G+ V V + W +G + G FP+ +V A Sbjct: 329 IHPFDAQADGELSISVGDYVVVRQVAPNGWSEGECKGKAGWFPSAYVEQRDKA 381 >03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324, 8746665-8746893,8747314-8747420,8747560-8747622, 8747883-8747983,8748996-8749090,8749330-8749350, 8749987-8750082,8750188-8750308,8750415-8750570, 8750679-8750869,8751207-8751478,8751853-8751954, 8752006-8752038,8752132-8752308,8752397-8752466, 8752512-8752585,8752667-8752908,8752983-8753129, 8753526-8753751,8753893-8753970,8754378-8754521, 8754829-8755008,8755335-8755394,8755484-8755523, 8758653-8759137 Length = 1294 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 Query: 293 LYDFEAAEDNELTFLAGETVHVTDSSDPNWW 385 LYDF A D+EL+ AGE V + D W+ Sbjct: 1090 LYDFTAGGDDELSLTAGEDVEIEYEVD-GWY 1119 >08_01_0189 + 1578935-1578950,1579227-1579390,1579493-1579605, 1579850-1580399,1580514-1580813,1581093-1581133, 1581359-1581606,1581983-1582086,1582177-1582323 Length = 560 Score = 27.1 bits (57), Expect = 7.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 368 SDPNWWKGYNERGEGLFPAN 427 SDPN+ K + +RG LF AN Sbjct: 70 SDPNYTKSWYDRGAKLFQAN 89 >08_01_0525 + 4564885-4565221,4565337-4565476,4565582-4565677, 4566079-4566146,4566542-4566643,4567492-4567630, 4567758-4567898,4568241-4568297,4568400-4568459, 4568866-4568973,4569834-4569994,4570453-4570531, 4571357-4571490,4571846-4571951,4572244-4572432, 4572595-4572822,4573028-4573183,4573491-4573532, 4573752-4573868,4573945-4574121 Length = 878 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 450 ALVSSVTKLAGKSPSPRSLYPFHQLGSLESVTCTVS 343 A+V + T+ + +P LY F +GSLE+V + S Sbjct: 163 AVVGNATRFYVMAVTPTRLYSFTGIGSLETVFASYS 198 >02_03_0069 - 14728968-14729368,14729434-14729800,14730099-14730149 Length = 272 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 428 SWLGRVPRRARCTLSTSWGHSSPSRALSRP 339 +W + R + T WGHS S ++S P Sbjct: 191 AWQSAIDSRWQAPHDTHWGHSRSSSSISMP 220 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,445,730 Number of Sequences: 37544 Number of extensions: 77112 Number of successful extensions: 345 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -