BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K02 (524 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0383 + 2990812-2990855,2991364-2991463,2991554-2991622,299... 29 2.3 03_06_0047 + 31266940-31268394 29 3.0 08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525,452... 27 9.2 01_07_0122 - 41196081-41196205,41197561-41198245,41198961-411993... 27 9.2 >05_01_0383 + 2990812-2990855,2991364-2991463,2991554-2991622, 2991724-2991960,2992045-2992228,2992307-2992442, 2992529-2992691,2992958-2993108,2993154-2993278, 2993349-2993504,2993792-2993860,2993951-2994019, 2994127-2994264,2994626-2994773,2994856-2994866, 2995212-2995352,2995441-2995569,2995860-2995899, 2996020-2996348,2996902-2996919 Length = 818 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 187 YTRYISDRRCAN--IRRNSAAVVMRVRKKLKTGLRIRRQDLPQPVPLVLREGQDAQRF 354 Y ++S R AN ++N A+ RV+ +R + DLP L++REG + RF Sbjct: 508 YKNFVSQRSDANGWYQKNGVAL-FRVQGLKHDCIRAIQVDLPLKQSLLVREGSEPDRF 564 >03_06_0047 + 31266940-31268394 Length = 484 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +2 Query: 263 RNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCEEADPCVCTF 409 R + C D TY ++CE DK LK+ K ++ P + TF Sbjct: 368 RRMIKCCQPDCDTYTMMIKMFCENDKVEMALKVWKYMRLKQFLPSMHTF 416 >08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525, 4521632-4521723,4522226-4522342,4522641-4522704, 4523175-4523228,4523579-4523666,4523788-4524023, 4525258-4525478,4525634-4525827,4525938-4525995, 4526771-4526824,4526851-4527473,4527580-4527640, 4528417-4528590,4528803-4529063,4529201-4529320, 4529388-4530022,4530062-4530828,4530915-4531012, 4531101-4531155,4531230-4531318 Length = 2010 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 435 SVPQTGAYMKVQTQGSASSHVPS 367 S Q G+ M+ Q+QG ASS +PS Sbjct: 1668 STVQNGSQMQQQSQGPASSAIPS 1690 >01_07_0122 - 41196081-41196205,41197561-41198245,41198961-41199329, 41199405-41199514,41200539-41200833 Length = 527 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 438 PSVPQTGAYMKVQTQGSASSHVPSFTIFKSLCVLSLSQYKRHWL 307 PSVP+ + T S+ + + T+F + +SLS Y RH L Sbjct: 291 PSVPRMKQLAQTITNSSSGNLGLNHTVFGRVKQISLSSYLRHSL 334 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,099,246 Number of Sequences: 37544 Number of extensions: 294745 Number of successful extensions: 793 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -