BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_K02 (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77270.1 68414.m08999 expressed protein 31 0.36 At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type f... 29 2.5 At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 29 2.5 At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly ... 27 7.7 At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit... 27 7.7 At3g48500.1 68416.m05294 expressed protein 27 7.7 >At1g77270.1 68414.m08999 expressed protein Length = 682 Score = 31.5 bits (68), Expect = 0.36 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 190 TRYISDRRCANIRRNSAAVVMRVRKKLKTGL-RIRRQDLPQPVPLVLREGQDAQRFENRE 366 TRY+ D + N R + + + R K+LKT + R + + P+V + +D QR +NRE Sbjct: 390 TRYVRDSQEKNTRNDESQTIFRASKRLKTEIGRADHNSISKTNPVV--KTKDIQR-KNRE 446 >At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 144 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 242 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 382 P+SC C R PVCG D TY C D +++VK+G C+ Sbjct: 68 PASCPVQCFRP-DPVCGEDSVTYWCGC-----ADALCHGVRVVKQGACD 110 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 275 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 382 PVCG+DG TY C D ++VK+G C+ Sbjct: 53 PVCGTDGVTYWCGC-----PDAACHGARVVKKGACD 83 >At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly identical to SP|P15455 [Plant Mol Biol 11:805-820 (1988)]; contains Pfam profile PF00190 Cupin and Prosite 11-S plant seed storage proteins signature PS00305 Length = 472 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 413 YAPVCGTDGNTYPNKCSLECSRPLAPSLEMK 505 YA G G +PN+C L+ L PS +K Sbjct: 21 YAAQQGQQGQQFPNECQLDQLNALEPSHVLK 51 >At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At2) / UFO-binding protein (UIP2) E3 ubiquitin ligase; skp1b; identical to UIP2 GI:3719211 from [Arabidopsis thaliana]; contains Pfam profiles PF01466: Skp1 family, dimerisation domain and PF03931:Skp1 family, tetramerisation domain; identical to cDNA UFO binding protein UIP2 mRNA, partial cds GI:3719210 Length = 171 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 240 CRRHARAQET*DRSADQTARLTTTSAS 320 C+RH A E + +AD A TTT+ + Sbjct: 60 CKRHVEAAEKSETTADAAAATTTTTVA 86 >At3g48500.1 68416.m05294 expressed protein Length = 668 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 407 FIYAPVCGTDGNTYPNKCSLECSRPLAP 490 F + P+ DG+T P++ +C RP P Sbjct: 354 FDFPPIFHRDGDTNPDEIRRDCGRPPEP 381 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,278,144 Number of Sequences: 28952 Number of extensions: 235837 Number of successful extensions: 649 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -