BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_J12 (405 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17A3.03c |||phosphoprotein phosphatase |Schizosaccharomyces ... 25 5.9 SPAC31A2.16 |gef2||RhoGEF Gef2|Schizosaccharomyces pombe|chr 1||... 25 5.9 SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22... 24 7.8 >SPBC17A3.03c |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 263 Score = 24.6 bits (51), Expect = 5.9 Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +2 Query: 5 WTGIYERNA--RIESYKMILSIAVLTLLIIQASPIPQEDASALLKYDELYYNIVI 163 + GI R+A R ++ + S+ + T++ ++ +ED K+ YY+I + Sbjct: 66 YPGIIYRSACPRASNFNFLESLHIRTIISLRQEEYSEEDLHYFTKHHINYYHIAM 120 >SPAC31A2.16 |gef2||RhoGEF Gef2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1101 Score = 24.6 bits (51), Expect = 5.9 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -2 Query: 365 KSSENVLGSNHGLCRFHPCLTKLIPRN 285 KSS+ +LG F PCL KLI N Sbjct: 265 KSSKKLLGLYELNTLFPPCLNKLIQLN 291 >SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1680 Score = 24.2 bits (50), Expect = 7.8 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 149 YNIVIGRYVSAARITMELKNEGRGEVIRLVVN 244 Y I+I R ++ +I +KN+ G+V L+ + Sbjct: 1556 YYIIIKRPIALGKIKRNIKNDRYGDVGELIAD 1587 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,533,134 Number of Sequences: 5004 Number of extensions: 26427 Number of successful extensions: 43 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 138190552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -