BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_J12 (405 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0180 + 32175658-32178145,32178765-32178808 28 3.2 03_02_0324 - 7463482-7463601,7463660-7463736,7463827-7463883,746... 26 9.9 03_01_0215 + 1696250-1696573,1697653-1697793,1698267-1698539,169... 26 9.9 >03_06_0180 + 32175658-32178145,32178765-32178808 Length = 843 Score = 27.9 bits (59), Expect = 3.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 170 YVSAARITMELKNEGRGEVIRLVVNXA 250 Y+S I +EL+ EG G++I ++ N A Sbjct: 816 YMSLKSILLELREEGHGDLIAMLSNTA 842 >03_02_0324 - 7463482-7463601,7463660-7463736,7463827-7463883, 7464154-7464246,7464528-7464654,7464836-7466794 Length = 810 Score = 26.2 bits (55), Expect = 9.9 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 404 ISEIDKLYFVHPIKSSENVLGSNHGLCRFH 315 I E V PIK +E V G+ G CR H Sbjct: 445 IREAYDFIMVMPIKPNERVWGALLGACRIH 474 >03_01_0215 + 1696250-1696573,1697653-1697793,1698267-1698539, 1698755-1698814,1698890-1699033 Length = 313 Score = 26.2 bits (55), Expect = 9.9 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 71 LTLLIIQASPIPQEDASALLKYDELYYNIVIGRYVSAARI 190 ++ LI +A + + L Y+++ +N+V+GRY S + Sbjct: 222 MSKLITRADDTEEVVRNRLQIYNDMVFNVVLGRYKSCTML 261 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,525,798 Number of Sequences: 37544 Number of extensions: 164830 Number of successful extensions: 294 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 706675332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -