BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_J10 (484 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38596| Best HMM Match : EGF (HMM E-Value=3.7e-06) 32 0.28 SB_49925| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.87 SB_59616| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_56740| Best HMM Match : RBD (HMM E-Value=0.21) 29 1.5 SB_24266| Best HMM Match : Transposase_35 (HMM E-Value=1.2) 29 1.5 SB_12987| Best HMM Match : Transposase_35 (HMM E-Value=1.2) 29 1.5 SB_53067| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_42801| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_42142| Best HMM Match : Transposase_35 (HMM E-Value=1.2) 29 1.5 SB_31167| Best HMM Match : Transposase_35 (HMM E-Value=1.2) 29 1.5 SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) 29 1.5 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 29 2.0 SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_42681| Best HMM Match : Transposase_35 (HMM E-Value=1.2) 29 2.7 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 29 2.7 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_34777| Best HMM Match : VWA (HMM E-Value=0) 29 2.7 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 28 4.6 SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_41768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_35096| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_24849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_16271| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_13227| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_10161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_58110| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_56490| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_50392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_31589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_31170| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_30092| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_20989| Best HMM Match : CRA_rpt (HMM E-Value=7.1) 28 4.6 SB_16467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_15251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_7233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_1101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_945| Best HMM Match : RecR (HMM E-Value=0.52) 28 4.6 SB_41885| Best HMM Match : SPC12 (HMM E-Value=3.4) 27 6.1 SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 27 6.1 SB_41995| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 6.1 >SB_38596| Best HMM Match : EGF (HMM E-Value=3.7e-06) Length = 605 Score = 31.9 bits (69), Expect = 0.28 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRESFRDL 219 C C G V+D EH+L+ CPA++ DL Sbjct: 522 CLVCQTGKVEDEEHSLLECPAYKNDRDDL 550 >SB_49925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 30.3 bits (65), Expect = 0.87 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRESFRDL 219 C C G V+D EH L+ CPA++ DL Sbjct: 102 CLVCQTGKVEDDEHFLLECPAYKNDRDDL 130 >SB_59616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 1170 CLVCQTGKVEDEEHFLLECPAYKD 1193 >SB_56740| Best HMM Match : RBD (HMM E-Value=0.21) Length = 320 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 137 CLVCQTGKVEDEEHFLLECPAYKD 160 >SB_24266| Best HMM Match : Transposase_35 (HMM E-Value=1.2) Length = 151 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 65 CLVCQTGKVEDEEHFLLECPAYKD 88 >SB_12987| Best HMM Match : Transposase_35 (HMM E-Value=1.2) Length = 219 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 160 CLVCQTGKVEDEEHFLLECPAYKD 183 >SB_53067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 206 CLVCQTGKVEDEEHFLLECPAYKD 229 >SB_42801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 106 CLVCQTGKVEDEEHFLLECPAYKD 129 >SB_42142| Best HMM Match : Transposase_35 (HMM E-Value=1.2) Length = 265 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 179 CLVCQTGKVEDEEHFLLECPAYKD 202 >SB_31167| Best HMM Match : Transposase_35 (HMM E-Value=1.2) Length = 169 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 132 CLVCQTGKVEDEEHFLLECPAYKD 155 >SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043) Length = 831 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWRE 234 C C G V+D EH L+ CPA+++ Sbjct: 421 CLVCQTGKVEDEEHFLLECPAYKD 444 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T V R P+ HD+R Sbjct: 295 RDRQQSRRTACSPPHSTTDREDGTLVERHAPQAPRSGPGHDKR 337 >SB_26060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2671 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 253 TTNVCSTSSTTPPAQ*LQHGESSLPS 330 +++ CSTSSTTP +HG+ S PS Sbjct: 1585 SSSSCSTSSTTPKKSVSKHGKLSEPS 1610 >SB_42681| Best HMM Match : Transposase_35 (HMM E-Value=1.2) Length = 144 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWR 237 C C G V+D EH L+ CPA++ Sbjct: 57 CLVCQTGKVEDKEHFLLECPAYK 79 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 244 RGGSPSGTWRPTWVGSSPCRRS*GRW 167 RGG G WRP W P R RW Sbjct: 864 RGGDKPGAWRPKWQREEPDRGG-DRW 888 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 305 CNHCAGGVVDDVEHTLVVCPAWR 237 C C G V+D EH L+ CPA++ Sbjct: 129 CLVCRTGKVEDEEHFLLECPAYK 151 >SB_34777| Best HMM Match : VWA (HMM E-Value=0) Length = 1268 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 157 ELPTIALTSDGKERTLPTSDAKSLKDSLHA-GHTTNVCSTSSTTPPAQ*LQHGESSL-PS 330 E PT+ +TSDG+ T+ DA+S + G T + S T Q H +S+ PS Sbjct: 295 ESPTVTVTSDGEHTTVKVLDAQSPTPKVTINGKTNDGKSADGNTKSQQNTTHDITSVDPS 354 Query: 331 V 333 + Sbjct: 355 L 355 >SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) Length = 196 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 132 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 174 >SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_41768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 59 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 101 >SB_35096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_24849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 32 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 74 >SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_16271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 19 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 61 >SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_13227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_10161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_58110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_56490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_50392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 19 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 61 >SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_31589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 27.9 bits (59), Expect = 4.6 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 298 TVPAESSTTS-STRWSCVPRGGSPSGTWRPTWVGSSP 191 T P ES TS ST C R SP T RP+ GS+P Sbjct: 16 TAPTESRATSLSTAGFCGRRSRSPPST-RPSRQGSAP 51 >SB_31170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_30092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_20989| Best HMM Match : CRA_rpt (HMM E-Value=7.1) Length = 138 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_16467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_15251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_7233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 65 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 107 >SB_1101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 135 RDNRPSPRAADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQR 263 RD + S R A PH ED T R P+ HD+R Sbjct: 22 RDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGPGHDKR 64 >SB_945| Best HMM Match : RecR (HMM E-Value=0.52) Length = 279 Score = 27.9 bits (59), Expect = 4.6 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +3 Query: 159 AADHRPHERRQGEDPTHVGRQVPEGLPPRGTHDQRVLDVVDDS 287 A D H+ R D G +V E PP +QRVLDV+++S Sbjct: 135 AEDDANHKLRMFLDIDTFGVRVDES-PPYSRSEQRVLDVLNES 176 >SB_41885| Best HMM Match : SPC12 (HMM E-Value=3.4) Length = 171 Score = 27.5 bits (58), Expect = 6.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 210 VGRQVPEGLPPRGTHDQRVLDVVD 281 +G Q+P PPRGTH Q ++ + Sbjct: 145 MGPQIPRIPPPRGTHSQPTKEITN 168 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 27.5 bits (58), Expect = 6.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 262 RWSCVPRGGSPSGTWR 215 RW C+ R SP G WR Sbjct: 955 RWYCISRMASPRGDWR 970 >SB_41995| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 785 Score = 27.5 bits (58), Expect = 6.1 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 335 GTLG-RELSPCCNHCAGGVVDDVEHTLVVCPAWRESFRDLASDVGRVLSLPSLV 177 GT+ R +P C++C GG + T+ C + + + L+S VG V+ + S V Sbjct: 552 GTISPRYAAPSCSNCTGGRTPNAARTM--CISEKMADNQLSSAVGVVIIVLSAV 603 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,710,327 Number of Sequences: 59808 Number of extensions: 219995 Number of successful extensions: 816 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 814 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -