BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_J09 (400 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 3.0 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 3.0 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 3.0 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 3.0 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 21 3.9 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 20 9.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 20 9.1 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 3.0 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = -2 Query: 393 YFIETYSPSC----YSYNINWNKTTSAASTPTLFIMKLVKKTEAH 271 Y TY P+C S+ W K +A + TL + L+ + H Sbjct: 247 YLFHTYIPTCLIVIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQH 291 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.8 bits (44), Expect = 3.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 64 EKLKKVISELNGKNV 108 +KLKK + E GKN+ Sbjct: 154 DKLKKKLEEWTGKNI 168 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.8 bits (44), Expect = 3.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 64 EKLKKVISELNGKNV 108 +KLKK + E GKN+ Sbjct: 169 DKLKKKLEEWTGKNI 183 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.8 bits (44), Expect = 3.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 64 EKLKKVISELNGKNV 108 +KLKK + E GKN+ Sbjct: 57 DKLKKKLEEWTGKNI 71 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 21.4 bits (43), Expect = 3.9 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 22 VEKILSSVGIEADSEKLKKVISELNGK 102 V K + +GI +K+K ++ EL K Sbjct: 28 VGKGMKVIGIAPQVDKMKTLVEELKSK 54 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.1 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -2 Query: 393 YFIETYSPSCYSYNINW 343 Y I+ Y P C ++W Sbjct: 244 YLIQIYIPCCMLVIVSW 260 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.1 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -2 Query: 393 YFIETYSPSCYSYNINW 343 Y I+ Y P C ++W Sbjct: 244 YLIQIYIPCCMLVIVSW 260 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,729 Number of Sequences: 438 Number of extensions: 1092 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -