BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_J06 (583 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 29 3.6 03_06_0337 + 33224333-33224479,33224603-33224663,33224740-332247... 27 8.2 >05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 Length = 518 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +3 Query: 105 NRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLS 236 NR+ R L++ +++ E I + CMKK+ ++N L +S Sbjct: 39 NRLLRSLVNIHEQETYSREIITEAIESCMKKQADNLVNTLDVIS 82 >03_06_0337 + 33224333-33224479,33224603-33224663,33224740-33224776, 33225237-33225367,33225447-33225590,33225686-33225776, 33225973-33226106,33226234-33226373,33227328-33227426, 33227520-33227602,33227690-33227744,33227826-33227937, 33228274-33228766,33228881-33229094,33229203-33229273, 33229733-33229901,33229991-33230120,33230556-33230968, 33231059-33231262 Length = 975 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/70 (24%), Positives = 30/70 (42%) Frame = +2 Query: 320 LRDPAFYQLYYRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATN 499 LRD A +R+ G I P P+E++ G++ + + F + + Sbjct: 214 LRDFAMASEVFRLAGEIGTVVSVSYPLPKEEMELHGLERDGCTTDAAAVLFASVKSAWDS 273 Query: 500 SVFLTKKEIK 529 V L +KE+K Sbjct: 274 VVHLHRKEVK 283 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,902,146 Number of Sequences: 37544 Number of extensions: 296218 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -