BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_J05 (510 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0809 + 24814590-24816593 29 2.9 07_03_1170 - 24505743-24505875,24506087-24506475,24507133-245073... 27 6.6 >06_03_0809 + 24814590-24816593 Length = 667 Score = 28.7 bits (61), Expect = 2.9 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 254 RLYQWRRNPSVHAVAVTPD-NATLVDPDYWDLDVFEPTIADYDKFDLTLTKRISSYSD 424 R ++WR N +H V + PD P W L T+AD D D + + Y + Sbjct: 313 RRWRWRGNGELHDVPLAPDKEGAKATPPPWMLPT---TVADVDVRDAVGSMAVYEYGE 367 >07_03_1170 - 24505743-24505875,24506087-24506475,24507133-24507369, 24507967-24508136,24510196-24510316 Length = 349 Score = 27.5 bits (58), Expect = 6.6 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +2 Query: 224 RGARSEATTARLYQWRRNPSVHAVAVTPDNATLVDPDYWDLDVFEPTIA 370 RG AT L ++ + + + L + D +D D FEP IA Sbjct: 29 RGCVVHATLRNLGDEKKTAPLRELPGAAERLVLFEADMYDADTFEPAIA 77 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,046,144 Number of Sequences: 37544 Number of extensions: 251560 Number of successful extensions: 577 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -