BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I23 (342 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.06c |||serine hydrolase|Schizosaccharomyces pombe|chr ... 24 7.5 SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces ... 23 9.8 SPBC17D11.01 |nep1||nedd8 protease Nep1|Schizosaccharomyces pomb... 23 9.8 >SPAC22A12.06c |||serine hydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 429 Score = 23.8 bits (49), Expect = 7.5 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 189 PFRFRLYIIANNRPIILHVLVH-IEVQLP 106 PFRF L+ RP+++ VH ++ LP Sbjct: 142 PFRFALFFSGYFRPLLMDGAVHATKLDLP 170 >SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces pombe|chr 3|||Manual Length = 761 Score = 23.4 bits (48), Expect = 9.8 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = +3 Query: 189 AHNQDLGYAGSCVRKFSTMPFLFCDLNDVCNYASRNDR 302 A +++ GY C + P F + +VC+ A ++ Sbjct: 621 AFSKEKGYRRLCFKIKGNSPMCFVEFEEVCHAAKAMEK 658 >SPBC17D11.01 |nep1||nedd8 protease Nep1|Schizosaccharomyces pombe|chr 2|||Manual Length = 420 Score = 23.4 bits (48), Expect = 9.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 228 RKFSTMPFLFCDLNDVCNYASRNDRSYWLSTGQPIP 335 +K +LF +ND+ +A+ + S+W IP Sbjct: 83 KKLMNCKYLFMPINDLDKHAAGSGGSHWSLMVASIP 118 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,406,830 Number of Sequences: 5004 Number of extensions: 27409 Number of successful extensions: 57 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 100068878 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -