BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I16 (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17180.1 68415.m01984 zinc finger (C2H2 type) family protein ... 31 0.63 At5g25160.1 68418.m02983 zinc finger (C2H2 type) family protein ... 30 0.83 At5g10970.1 68418.m01275 zinc finger (C2H2 type) family protein ... 30 0.83 At1g66140.1 68414.m07506 zinc finger (C2H2 type) family protein ... 30 0.83 At1g80730.1 68414.m09472 zinc finger (C2H2 type) family protein ... 30 1.1 At5g64170.1 68418.m08057 dentin sialophosphoprotein-related cont... 29 1.4 At5g57520.1 68418.m07187 zinc finger (C2H2 type) family protein ... 29 2.5 At5g40710.1 68418.m04941 zinc finger (C2H2 type) family protein ... 29 2.5 At4g06634.1 68417.m01050 zinc finger (C2H2 type) family protein ... 28 3.3 At1g24625.1 68414.m03099 zinc finger (C2H2 type) family protein ... 28 4.4 At4g12240.1 68417.m01941 zinc finger (C2H2 type) family protein ... 27 5.8 At5g60140.1 68418.m07539 transcriptional factor B3 family protei... 27 7.7 At5g24670.1 68418.m02916 cytidine/deoxycytidylate deaminase fami... 27 7.7 At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein ... 27 7.7 At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-conta... 27 7.7 >At2g17180.1 68415.m01984 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 270 Score = 30.7 bits (66), Expect = 0.63 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 3 EKRYSCDICQKRFYDRTKLNRHIDSHNDIK 92 E+R+ CD C+K F L H +H D+K Sbjct: 145 EERFECDGCKKVFGSHQALGGHRATHKDVK 174 >At5g25160.1 68418.m02983 zinc finger (C2H2 type) family protein (ZFP3) identical to zinc finger protein, ZFP3 gi|790677|gb|AAA87299; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 235 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 3 EKRYSCDICQKRFYDRTKLNRHIDSHNDIKR*GKR 107 +K +SC+ CQ+ FY L H ++H + KR Sbjct: 58 QKLFSCNYCQRTFYSSQALGGHQNAHKRERTLAKR 92 >At5g10970.1 68418.m01275 zinc finger (C2H2 type) family protein contains zinc finger, C2H2 type domain, Prosite:PS00028 Length = 272 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 3 EKRYSCDICQKRFYDRTKLNRHIDSHNDIKR*GKR 107 +K +SC+ CQ+ FY L H ++H + KR Sbjct: 101 QKLFSCNYCQRTFYSSQALGGHQNAHKRERTLAKR 135 >At1g66140.1 68414.m07506 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 260 Score = 30.3 bits (65), Expect = 0.83 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 12 YSCDICQKRFYDRTKLNRHIDSHNDIKR*GKRKITEKMDGL 134 +SC+ CQ++FY L H ++H + KR + + G+ Sbjct: 85 FSCNYCQRKFYSSQALGGHQNAHKRERTLAKRAMRMGLAGV 125 >At1g80730.1 68414.m09472 zinc finger (C2H2 type) family protein (ZFP1) identical to zinc finger protein, ZFP1 gi|790673|gb|AAA87297; contains zinc finger, C2H2 type, domain, Prosite:PS00028 Length = 228 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 12 YSCDICQKRFYDRTKLNRHIDSHNDIKR*GKRKITEKM 125 +SC+ CQ++FY L H ++H + KR KM Sbjct: 68 FSCNYCQRKFYSSQALGGHQNAHKRERTLAKRGQYYKM 105 >At5g64170.1 68418.m08057 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor [Homo sapiens] Length = 566 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 92 KVGEEEDHRKDGWTLKVSAWNESECDTEMMNDI 190 K+G E DHRK L+ S S C + +++DI Sbjct: 395 KIGLENDHRKAATELETSNMQGSSCVSSVVDDI 427 >At5g57520.1 68418.m07187 zinc finger (C2H2 type) family protein (ZFP2) identical to zinc finger protein 2 (ZFP2) GI:790674 from [Arabidopsis thaliana]; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 150 Score = 28.7 bits (61), Expect = 2.5 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 Query: 12 YSCDICQKRFYDRTKLNRHIDSH 80 +SC+ CQ++FY L H ++H Sbjct: 52 FSCNYCQRKFYSSQALGGHQNAH 74 >At5g40710.1 68418.m04941 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 272 Score = 28.7 bits (61), Expect = 2.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 12 YSCDICQKRFYDRTKLNRHIDSHN 83 + C C+K FY+ L++H DS + Sbjct: 107 WRCGFCKKAFYEEKYLDKHFDSRH 130 >At4g06634.1 68417.m01050 zinc finger (C2H2 type) family protein contains Pfam PF00096: Zinc finger, C2H2 type Length = 387 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +3 Query: 3 EKRYSCDI--CQKRFYDRTKLNRHIDSH 80 E++Y CD C K+F D +KL RH H Sbjct: 105 ERQYVCDQEGCGKKFLDSSKLKRHYLIH 132 >At1g24625.1 68414.m03099 zinc finger (C2H2 type) family protein (ZFP7) identical to zinc finger protein, ZFP7 gi|790685|gb|AAA87303; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 209 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 12 YSCDICQKRFYDRTKLNRHIDSHNDIKR*GKR 107 +SC+ C+++FY L H ++H + KR Sbjct: 59 FSCNYCRRKFYSSQALGGHQNAHKRERTMAKR 90 >At4g12240.1 68417.m01941 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 364 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 12 YSCDICQKRFYDRTKLNRHIDSHNDIKR*GKRKITEKMDG 131 Y C +C +RFY KL H ++ + + + E G Sbjct: 117 YFCGVCDRRFYTNEKLINHFKQIHETENQKRMRQIESSKG 156 >At5g60140.1 68418.m07539 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 328 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 101 EEEDHRKDGWTLKVSAWNESECDTEMMNDI*RYIEPH 211 E++D +DG+ K E E D E +D RY++ H Sbjct: 194 EDDDEAEDGYDAKDDDGLEDEDDLEDEDDERRYLDDH 230 >At5g24670.1 68418.m02916 cytidine/deoxycytidylate deaminase family protein similar to SP|Q9URQ3 tRNA-specific adenosine deaminase 3 (EC 3.5.4.-) (tRNA-specific adenosine-34 deaminase subunit TAD3) {Saccharomyces cerevisiae}; contains Pfam profile PF00383: Cytidine and deoxycytidylate deaminase zinc-binding region Length = 432 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 170 TEMMNDI*RYIEPHPLSSFLTKTTFCPQIRPL 265 ++M D+ R ++P+ LS F+T+ + I PL Sbjct: 87 SDMPPDVQRLVDPYELSPFITQVGYFSLISPL 118 >At2g02080.1 68415.m00144 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 516 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 9 RYSCDICQKRFYDRTKLNRHIDSHN 83 R+ CD+C K F L H HN Sbjct: 82 RFICDVCNKGFQREQNLQLHRRGHN 106 >At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-containing protein contains Pfam domains PF00226: DnaJ domain and PF00096: Zinc finger, C2H2 type Length = 630 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +3 Query: 18 CDICQKRFYDRTKLNRHI-DS-HNDIK 92 CD C + F RTKL++H+ DS H +K Sbjct: 602 CDRCGEEFESRTKLHKHLADSGHATVK 628 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,034,605 Number of Sequences: 28952 Number of extensions: 188323 Number of successful extensions: 561 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -