BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I11 (558 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003740-9|AAC48140.1| 852|Caenorhabditis elegans Hypothetical ... 29 3.0 AC084158-29|AAL27264.2| 666|Caenorhabditis elegans Yeast smf (d... 27 6.9 AC024757-4|AAK68429.2| 371|Caenorhabditis elegans Methionine am... 27 9.1 >AF003740-9|AAC48140.1| 852|Caenorhabditis elegans Hypothetical protein C41D11.6 protein. Length = 852 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 138 PLLLADIVAQV*QCLNWRQKIRHTHQTIIDAVAYRN 31 P+L ++ +V Q +N R +R TH IIDA + N Sbjct: 718 PILWREVFTEVVQSVN-RPNVRGTHPAIIDAARHLN 752 >AC084158-29|AAL27264.2| 666|Caenorhabditis elegans Yeast smf (divalent cation transporter)homolog protein 3 protein. Length = 666 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 25 YFISICYGIYYCLVCMAYFLP 87 Y I I Y YYCLV M + P Sbjct: 606 YIIFIAYLTYYCLVAMEFISP 626 >AC024757-4|AAK68429.2| 371|Caenorhabditis elegans Methionine aminopeptidase protein 1 protein. Length = 371 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -3 Query: 130 VGGYCGPGITMFKLAAKNTPYTPNNNRCRSISK*NMKTYE 11 V GYCG GI A N P+ NN + N T E Sbjct: 270 VKGYCGHGIHRLFHTAPNVPHYAKNNATGVMKAGNSFTIE 309 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,930,028 Number of Sequences: 27780 Number of extensions: 314011 Number of successful extensions: 863 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -