BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I08 (536 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-1924|AAF55118.1| 868|Drosophila melanogaster CG3837-PA... 28 7.0 AE013599-302|AAF59293.1| 328|Drosophila melanogaster CG12835-PA... 28 9.3 >AE014297-1924|AAF55118.1| 868|Drosophila melanogaster CG3837-PA protein. Length = 868 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 26 PFDEKDIVVKARTGLLMVQAVHKYEGDVQ-KNYLDVRTLPDCVNVNGSWT 172 P ++K+I+V G++ Q + GD K+ D+ L DCV +NGS T Sbjct: 311 PGNQKEILVAK--GIIHCQV--ECNGDFHVKSAADLEVLQDCVTINGSLT 356 >AE013599-302|AAF59293.1| 328|Drosophila melanogaster CG12835-PA protein. Length = 328 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 Query: 35 EKDIVVKARTGLLMVQAVHKYEGDVQKNYLDVRTLPDCVNVNGSW 169 + D+ V TG L + + +G Y D+R L C N N W Sbjct: 224 DDDVEVAMLTGSLTPSQIARIQGQQILRYDDLRNLNRCRNRNAVW 268 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,707,882 Number of Sequences: 53049 Number of extensions: 465459 Number of successful extensions: 1114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -