BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I07 (555 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016415-2|AAW88413.1| 296|Caenorhabditis elegans Serpentine re... 30 0.97 AC024791-29|AAL32249.2| 1599|Caenorhabditis elegans Lipid deplet... 29 2.2 Z82090-4|CAB05008.2| 543|Caenorhabditis elegans Hypothetical pr... 27 9.1 >AF016415-2|AAW88413.1| 296|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 29 protein. Length = 296 Score = 30.3 bits (65), Expect = 0.97 Identities = 19/63 (30%), Positives = 35/63 (55%) Frame = -3 Query: 325 VLVSVVLISNICALCNLLLNSSDPHLNLIRN*YCKKDLRQIYYRLV*IMVGIGTKYLRLI 146 +LV V++ +CA+ ++LLN + + +++ K ++R YYR V + V G L I Sbjct: 4 ILVLVLVTGIVCAIFDVLLNLNLVWIIVLKKSQRKPEMRLFYYRFV-LDVCFGLSLLSYI 62 Query: 145 ADL 137 + L Sbjct: 63 SFL 65 >AC024791-29|AAL32249.2| 1599|Caenorhabditis elegans Lipid depleted protein 3 protein. Length = 1599 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 134 SDCRATVPGLTLEISYTGTDANEDS*KAGLSTDSAFTAFV 15 +DC T+P LTLE++ T N D+ G+ F F+ Sbjct: 783 ADCLLTLPRLTLELTSKRTRDNIDNYVGGIHISGQFKGFM 822 >Z82090-4|CAB05008.2| 543|Caenorhabditis elegans Hypothetical protein ZK337.2 protein. Length = 543 Score = 27.1 bits (57), Expect = 9.1 Identities = 19/69 (27%), Positives = 34/69 (49%) Frame = +1 Query: 49 PAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTSYQYQPLSIPAYNRFGGDPSYS 228 PA S+ A +Y+ + +P + + P +TAD + Q S ++ P+Y+ Sbjct: 35 PALVISTIACPTIYEQAPSKPASPTMPLSPYEGITADLMQRIQLFS-SQFDHARLSPNYA 93 Query: 229 TNSVSGSSA 255 T+ + GSSA Sbjct: 94 TSDL-GSSA 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,400,130 Number of Sequences: 27780 Number of extensions: 286639 Number of successful extensions: 1018 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1134321766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -