BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I05 (580 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.5 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.5 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 3.3 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 22 4.3 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.5 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -3 Query: 143 ISIITPNGEDTTFLSFD--DVYVSLRN 69 IS I P G+DTT S D +YV L N Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLIN 384 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.5 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -3 Query: 143 ISIITPNGEDTTFLSFD--DVYVSLRN 69 IS I P G+DTT S D +YV L N Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLIN 384 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.5 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -3 Query: 143 ISIITPNGEDTTFLSFD--DVYVSLRN 69 IS I P G+DTT S D +YV L N Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLIN 384 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.5 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -3 Query: 143 ISIITPNGEDTTFLSFD--DVYVSLRN 69 IS I P G+DTT S D +YV L N Sbjct: 358 ISEIIPTGDDTTMDSNDMTAIYVLLIN 384 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 281 SLWPIKSTSEINILWMRNSRSLSVS 355 SL+P+KST +N++ RS+ ++ Sbjct: 317 SLYPLKSTFYLNVVRPFPERSMGIT 341 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +1 Query: 445 HIKSPISDDTIDPNAAAALFNVIFFQGH 528 H++SPI + + P+ FN+ H Sbjct: 90 HVESPIDEKFVHPHRFRLKFNISSIPRH 117 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +1 Query: 199 LGNGDYSGVANPYISLSKTFSEMNPDYFTMANK 297 L +GDY+ + + + NP YF +K Sbjct: 75 LASGDYTLPVGTTVGIGQFLVHRNPKYFPNPDK 107 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.131 0.370 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,109 Number of Sequences: 336 Number of extensions: 2921 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -