BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I04 (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24180.1 68417.m03470 pathogenesis-related thaumatin family p... 31 0.98 At2g40770.1 68415.m05030 SNF2 domain-containing protein / helica... 30 1.3 At4g11310.1 68417.m01827 cysteine proteinase, putative contains ... 30 1.7 At5g22540.1 68418.m02630 expressed protein contains Pfam profile... 29 2.3 At2g45870.1 68415.m05705 expressed protein contains Pfam profile... 29 2.3 At3g62160.1 68416.m06984 transferase family protein low similari... 29 3.0 At3g52970.1 68416.m05839 cytochrome P450 family protein cytochro... 28 5.2 At5g49850.1 68418.m06173 jacalin lectin family protein similar t... 28 6.9 At5g15510.1 68418.m01816 expressed protein 27 9.1 At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containi... 27 9.1 At1g77920.1 68414.m09080 bZIP family transcription factor contai... 27 9.1 >At4g24180.1 68417.m03470 pathogenesis-related thaumatin family protein similar to SP|P28493 Pathogenesis-related protein 5 precursor (PR-5) {Arabidopsis thaliana}; contains Pfam profile PF00314: Thaumatin family Length = 255 Score = 30.7 bits (66), Expect = 0.98 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -2 Query: 166 GIVTSLNRRVPREFRYGTQAVCKT 95 G VT LN++ P E R+G+ + CK+ Sbjct: 165 GCVTDLNQKCPTELRFGSGSACKS 188 >At2g40770.1 68415.m05030 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger (C3HC4 type RING finger) family protein low similarity to SP|P36607 DNA repair protein rad8 {Schizosaccharomyces pombe}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1648 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 315 ARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQ 458 AR++I T+KR + P+ + +++N L+KL A C Q Sbjct: 719 AREVIETLKRDILKRGHTSSDNPLVTHAEAAKLLNSLLKLRQACCHPQ 766 >At4g11310.1 68417.m01827 cysteine proteinase, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 364 Score = 29.9 bits (64), Expect = 1.7 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 1/127 (0%) Frame = +2 Query: 206 DNYNLHSVKNYEAIRFLDIFEKTFVQSLQK-GKFESYGKKIDFHDEKAINFVGNYWQENA 382 DN LHSV + EA IFE V+ + G +++ ++ + F+ N EN Sbjct: 33 DNNRLHSVFDAEASL---IFESWMVKHGKVYGSVAEKERRLTIFEDN-LRFINNRNAENL 88 Query: 383 DLYEEEVTKDYQRSYEIVARHVLGAAPKPFDKHTFMPSALDFYQTALRDPAFYQLYYRIV 562 Y +T S GA P+P H FM S+ D Y+T+ D + +R Sbjct: 89 S-YRLGLTGFADLSLHEYKEVCHGADPRPPRNHVFMTSS-DRYKTSADDVLPKSVDWRNE 146 Query: 563 GYINAFK 583 G + K Sbjct: 147 GAVTEVK 153 >At5g22540.1 68418.m02630 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 440 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 239 EAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFV 358 EA LD+ KTFV + + + + K F+D + + FV Sbjct: 217 EAKHLLDLIRKTFVPVPSQRRIKDHSSKSSFNDHEYLGFV 256 >At2g45870.1 68415.m05705 expressed protein contains Pfam profile PF05249: Uncharacterised protein family (UPF0187) Length = 410 Score = 29.5 bits (63), Expect = 2.3 Identities = 24/77 (31%), Positives = 40/77 (51%) Frame = +3 Query: 294 KANSNRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNHS 473 K++ + ++ KLIS +K S+ I +R + K+ L N + S S++HL H Sbjct: 49 KSDDSPLSEKLISLLKAVPNWSDGIKERR-MQQKRSLYTHENWVRHRS----SLRHLRHV 103 Query: 474 TSTPSCPVRLTFTKPHF 524 +S+PS V L+ P F Sbjct: 104 SSSPSSRVILSLIPPVF 120 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 Query: 163 IVTSLNRRVPREFRYGTQAVCKTLEVITCC 74 I + L R REFR T +C EVI C Sbjct: 224 IPSDLIERFKREFRASTGEICSAFEVIAAC 253 >At3g52970.1 68416.m05839 cytochrome P450 family protein cytochrome P450 76A2, eggplant, PIR:S38534 Length = 516 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = +2 Query: 317 KKIDFHDEKAINFVGNYWQENADLYE----EEVTKDY 415 +K FH EKA G + +E ++ E +E TKDY Sbjct: 242 RKTQFHVEKAFEIAGEFIRERTEVREREKSDEKTKDY 278 >At5g49850.1 68418.m06173 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 596 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/59 (20%), Positives = 25/59 (42%) Frame = +2 Query: 29 KHRRGEIYYNFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYYFPFAQRP 205 K +G F ++ + F + G + WY+P+ GY + ++++P P Sbjct: 386 KTSKGRTSRTFGERTSDSVEFVIESKGCAVVGFHGWYAPLGAGYITALGAHFYPMPLPP 444 >At5g15510.1 68418.m01816 expressed protein Length = 497 Score = 27.5 bits (58), Expect = 9.1 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 3/77 (3%) Frame = +2 Query: 320 KIDFHDEKAINFVGNYWQENA---DLYEEEVTKDYQRSYEIVARHVLGAAPKPFDKHTFM 490 + D+ + ++F+ Y E L EEE + ++ E+V + A P P+ F+ Sbjct: 397 EFDYQVAEKMSFIEQYKMERERQQKLAEEEEIRRLRK--ELVPK----AQPMPYFDRPFI 450 Query: 491 PSALDFYQTALRDPAFY 541 P + TA RDP F+ Sbjct: 451 PRRSSKHPTAPRDPKFH 467 >At4g30825.1 68417.m04371 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 904 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 560 QSCNIADRMQGLEVRFGKSQAHW 492 Q C++ D++Q L R KS HW Sbjct: 640 QKCDLQDKLQHLYYRIRKSGIHW 662 >At1g77920.1 68414.m09080 bZIP family transcription factor contains Pfam profile: PF00170 bZIP transcription factor Length = 368 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 488 MPSALDFYQTALRDPAFYQLYYRIVGYINAFKHYLKPYPP 607 M S+ +LRD Y+ + +IVG+ N FK + + P Sbjct: 2 MSSSSPTQLASLRDMGIYEPFQQIVGWGNVFKSDINDHSP 41 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,345,297 Number of Sequences: 28952 Number of extensions: 325265 Number of successful extensions: 907 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -