BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_I02 (306 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC015806-1|AAH15806.1| 665|Homo sapiens SH3-domain kinase bindi... 28 4.6 AY542305-1|AAT08174.1| 665|Homo sapiens GIG10 protein. 28 4.6 AY423734-1|AAS00497.1| 665|Homo sapiens migration-inducing gene... 28 4.6 AL772197-2|CAH71710.1| 665|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL772197-1|CAH71709.1| 553|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732423-6|CAI40280.1| 645|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732423-5|CAI40278.1| 427|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732423-4|CAI40277.1| 628|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732423-3|CAI40276.1| 665|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732327-6|CAI40514.1| 645|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732327-4|CAI40512.1| 427|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732327-3|CAI40511.1| 628|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732327-2|CAI40510.1| 665|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732327-1|CAI40509.1| 553|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732325-3|CAI41254.1| 628|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732325-2|CAI41253.1| 665|Homo sapiens SH3-domain kinase bindi... 28 4.6 AL732325-1|CAI41252.1| 553|Homo sapiens SH3-domain kinase bindi... 28 4.6 AF542051-1|AAN77231.1| 628|Homo sapiens CD2 binding protein CD2... 28 4.6 AF329268-1|AAO13348.1| 404|Homo sapiens SH3-domain kinase bindi... 28 4.6 AF329267-1|AAK95587.1| 404|Homo sapiens SH3-domain kinase bindi... 28 4.6 AF230904-1|AAF37854.1| 665|Homo sapiens c-Cbl-interacting prote... 28 4.6 X87175-1|CAA60642.1| 458|Homo sapiens ER81 protein protein. 28 6.1 U17163-1|AAA79844.1| 477|Homo sapiens ETV1 protein. 28 6.1 BC106763-1|AAI06764.1| 477|Homo sapiens ets variant gene 1 prot... 28 6.1 BC106762-1|AAI06763.1| 477|Homo sapiens ets variant gene 1 prot... 28 6.1 BC098403-1|AAH98403.1| 477|Homo sapiens ets variant gene 1 prot... 28 6.1 AF109632-2|AAD29878.1| 459|Homo sapiens ets variant protein ER8... 28 6.1 AF109632-1|AAD29877.1| 477|Homo sapiens ets variant protein ETV... 28 6.1 AC004857-1|AAC62435.1| 454|Homo sapiens ETS-related transcripti... 28 6.1 M74547-1|AAA36397.1| 935|Homo sapiens p107 protein. 27 8.1 L14812-1|AAA02489.1| 1068|Homo sapiens p107 protein. 27 8.1 BC131620-1|AAI31621.1| 523|Homo sapiens dynein, cytoplasmic 1, ... 27 8.1 BC032247-1|AAH32247.1| 1014|Homo sapiens retinoblastoma-like 1 (... 27 8.1 AL391114-2|CAI95152.1| 1014|Homo sapiens retinoblastoma-like 1 (... 27 8.1 AL391114-1|CAI95151.1| 1068|Homo sapiens retinoblastoma-like 1 (... 27 8.1 AL365505-2|CAI95178.1| 1014|Homo sapiens retinoblastoma-like 1 (... 27 8.1 AL365505-1|CAI95177.1| 1068|Homo sapiens retinoblastoma-like 1 (... 27 8.1 AL136172-4|CAI95717.1| 1014|Homo sapiens retinoblastoma-like 1 (... 27 8.1 AL136172-3|CAI95716.1| 1068|Homo sapiens retinoblastoma-like 1 (... 27 8.1 AK222653-1|BAD96373.1| 523|Homo sapiens dynein light chain-A va... 27 8.1 AK222573-1|BAD96293.1| 523|Homo sapiens dynein light chain-A va... 27 8.1 >BC015806-1|AAH15806.1| 665|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >AY542305-1|AAT08174.1| 665|Homo sapiens GIG10 protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >AY423734-1|AAS00497.1| 665|Homo sapiens migration-inducing gene 18 protein protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >AL772197-2|CAH71710.1| 665|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >AL772197-1|CAH71709.1| 553|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 553 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 444 PKKPRPPKTNSLSRPGALPP 463 >AL732423-6|CAI40280.1| 645|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 645 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 380 PKKPRPPKTNSLSRPGALPP 399 >AL732423-5|CAI40278.1| 427|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 427 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 162 PKKPRPPKTNSLSRPGALPP 181 >AL732423-4|CAI40277.1| 628|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 628 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 363 PKKPRPPKTNSLSRPGALPP 382 >AL732423-3|CAI40276.1| 665|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >AL732327-6|CAI40514.1| 645|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 645 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 380 PKKPRPPKTNSLSRPGALPP 399 >AL732327-4|CAI40512.1| 427|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 427 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 162 PKKPRPPKTNSLSRPGALPP 181 >AL732327-3|CAI40511.1| 628|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 628 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 363 PKKPRPPKTNSLSRPGALPP 382 >AL732327-2|CAI40510.1| 665|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >AL732327-1|CAI40509.1| 553|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 553 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 444 PKKPRPPKTNSLSRPGALPP 463 >AL732325-3|CAI41254.1| 628|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 628 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 363 PKKPRPPKTNSLSRPGALPP 382 >AL732325-2|CAI41253.1| 665|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >AL732325-1|CAI41252.1| 553|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 553 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 444 PKKPRPPKTNSLSRPGALPP 463 >AF542051-1|AAN77231.1| 628|Homo sapiens CD2 binding protein CD2BP3 protein. Length = 628 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 363 PKKPRPPKTNSLSRPGALPP 382 >AF329268-1|AAO13348.1| 404|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 404 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 139 PKKPRPPKTNSLSRPGALPP 158 >AF329267-1|AAK95587.1| 404|Homo sapiens SH3-domain kinase binding protein 1 protein. Length = 404 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 139 PKKPRPPKTNSLSRPGALPP 158 >AF230904-1|AAF37854.1| 665|Homo sapiens c-Cbl-interacting protein protein. Length = 665 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 34 PKEPRSPRSNSLSRVAHVSP 93 PK+PR P++NSLSR + P Sbjct: 400 PKKPRPPKTNSLSRPGALPP 419 >X87175-1|CAA60642.1| 458|Homo sapiens ER81 protein protein. Length = 458 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 70 IKKEPHSPCSEISSACSQEQPFKFSYGE 97 >U17163-1|AAA79844.1| 477|Homo sapiens ETV1 protein. Length = 477 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 88 IKKEPHSPCSEISSACSQEQPFKFSYGE 115 >BC106763-1|AAI06764.1| 477|Homo sapiens ets variant gene 1 protein. Length = 477 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 88 IKKEPHSPCSEISSACSQEQPFKFSYGE 115 >BC106762-1|AAI06763.1| 477|Homo sapiens ets variant gene 1 protein. Length = 477 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 88 IKKEPHSPCSEISSACSQEQPFKFSYGE 115 >BC098403-1|AAH98403.1| 477|Homo sapiens ets variant gene 1 protein. Length = 477 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 88 IKKEPHSPCSEISSACSQEQPFKFSYGE 115 >AF109632-2|AAD29878.1| 459|Homo sapiens ets variant protein ER81 protein. Length = 459 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 70 IKKEPHSPCSEISSACSQEQPFKFSYGE 97 >AF109632-1|AAD29877.1| 477|Homo sapiens ets variant protein ETV1 protein. Length = 477 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 88 IKKEPHSPCSEISSACSQEQPFKFSYGE 115 >AC004857-1|AAC62435.1| 454|Homo sapiens ETS-related transcription factor (binds CGGAW) protein. Length = 454 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 31 LPKEPRSPRSNSLSRVAHVSPFKFPNGE 114 + KEP SP S S + PFKF GE Sbjct: 88 IKKEPHSPCSEISSACSQEQPFKFSYGE 115 >M74547-1|AAA36397.1| 935|Homo sapiens p107 protein. Length = 935 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 829 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 862 >L14812-1|AAA02489.1| 1068|Homo sapiens p107 protein. Length = 1068 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >BC131620-1|AAI31621.1| 523|Homo sapiens dynein, cytoplasmic 1, light intermediate chain 1 protein. Length = 523 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 10 PVSRSPNLPK-EPRSPRSNSLSRVAHVSP 93 PV SP +P PR+P + S VA VSP Sbjct: 394 PVDASPRVPGGSPRTPNRSVSSNVASVSP 422 >BC032247-1|AAH32247.1| 1014|Homo sapiens retinoblastoma-like 1 (p107) protein. Length = 1014 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >AL391114-2|CAI95152.1| 1014|Homo sapiens retinoblastoma-like 1 (p107) protein. Length = 1014 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >AL391114-1|CAI95151.1| 1068|Homo sapiens retinoblastoma-like 1 (p107) protein. Length = 1068 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >AL365505-2|CAI95178.1| 1014|Homo sapiens retinoblastoma-like 1 (p107) protein. Length = 1014 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >AL365505-1|CAI95177.1| 1068|Homo sapiens retinoblastoma-like 1 (p107) protein. Length = 1068 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >AL136172-4|CAI95717.1| 1014|Homo sapiens retinoblastoma-like 1 (p107) protein. Length = 1014 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >AL136172-3|CAI95716.1| 1068|Homo sapiens retinoblastoma-like 1 (p107) protein. Length = 1068 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 10 PVSRSPNLPKEPRSPRSNSLSRVAHVSPFKFPNG 111 P+S P++ ++P SPR S ++SP K +G Sbjct: 962 PLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSG 995 >AK222653-1|BAD96373.1| 523|Homo sapiens dynein light chain-A variant protein. Length = 523 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 10 PVSRSPNLPK-EPRSPRSNSLSRVAHVSP 93 PV SP +P PR+P + S VA VSP Sbjct: 394 PVDASPRVPGGSPRTPNRSVSSNVASVSP 422 >AK222573-1|BAD96293.1| 523|Homo sapiens dynein light chain-A variant protein. Length = 523 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 10 PVSRSPNLPK-EPRSPRSNSLSRVAHVSP 93 PV SP +P PR+P + S VA VSP Sbjct: 394 PVDASPRVPGGSPRTPNRSVSSNVASVSP 422 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,209,399 Number of Sequences: 237096 Number of extensions: 621346 Number of successful extensions: 1660 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 1600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1660 length of database: 76,859,062 effective HSP length: 78 effective length of database: 58,365,574 effective search space used: 1342408202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -