BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H19 (470 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 116 1e-28 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 0.81 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 116 bits (278), Expect = 1e-28 Identities = 59/140 (42%), Positives = 89/140 (63%), Gaps = 4/140 (2%) Frame = +2 Query: 8 PIALVLAPTRELAQQIQQVASEFGNSSYVRNTCVFGGAPKREQARDLERGVEIVIATPGR 187 P+ ++++PTRELA QI +F +S V+ ++GG Q + G I++ATPGR Sbjct: 236 PVVVIMSPTRELAIQIADQGKKFAYNSTVKVAVIYGGTSTNHQRGRILGGCHILVATPGR 295 Query: 188 LIDFLKKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIID-QIRP---DRQTLMWSATWP 355 L DF+ +G + Y VLDEADRMLDMGF + +++ Q P +RQTLM+SAT+P Sbjct: 296 LKDFVNRGNVSFNSLKYFVLDEADRMLDMGFLGDVEEMLSHQSMPATGERQTLMFSATFP 355 Query: 356 KEVRKLAEDYLGDYVQINIG 415 +EV++LA +L +Y+ I +G Sbjct: 356 EEVQQLAGKFLLNYIFIAVG 375 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 0.81 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 48 NKYSRLLQNLAIHLMFVIHV 107 +KYSRL+ N A F+ HV Sbjct: 1484 DKYSRLVNNPAARARFIKHV 1503 Score = 23.0 bits (47), Expect = 1.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 48 NKYSRLLQNLAIHLMFVIHV 107 +KYSRL+ N + F+ HV Sbjct: 1909 DKYSRLVNNPSARRRFIAHV 1928 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 48 NKYSRLLQNLAIHLMFVIHV 107 NKYSRL+ + F+ HV Sbjct: 2407 NKYSRLVNDPQARAAFIAHV 2426 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,931 Number of Sequences: 336 Number of extensions: 2518 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -