BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_H15 (568 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 8.6 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 8.6 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 8.6 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 311 TYLELGLPGARLDFLMSERNQGDTFSDFDTMTD 409 T + L LPG +++ E DT+ ++ D Sbjct: 365 TTMSLLLPGVAVNYYGDEIGMSDTYISWEDTQD 397 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 507 DLIIIVPKECPTKLIRAGSLEF 442 D+I+ VPKE L G++ + Sbjct: 704 DIILNVPKESTQSLTTTGNVSY 725 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +2 Query: 311 TYLELGLPGARLDFLMSERNQGDTFSDFDTMTD 409 T + L LPG +++ E DT+ ++ D Sbjct: 365 TTMSLLLPGVAVNYYGDEIGMSDTYISWEDTQD 397 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,813 Number of Sequences: 438 Number of extensions: 3801 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -